DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and SRP2

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_179060.1 Gene:SRP2 / 815941 AraportID:AT2G14540 Length:407 Species:Arabidopsis thaliana


Alignment Length:442 Identity:105/442 - (23%)
Similarity:194/442 - (43%) Gaps:99/442 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PELSFLN-----EFSQIFKGERDFSLALM-KQIREIYPSGNLFFSPFS---------------TY 66
            |.||..|     :..:..|.:.:.||.|: |.|..:..:.|..|||.|               |.
plant    18 PSLSKTNKKQKIDMQEAMKNQNEVSLLLVGKVISAVAKNSNCVFSPASINAVLTVTAANTDNKTL 82

  Fly    67 NALLLAYF--SSSEQTE---RELAQALNLGWALNKQQVLVSYTLAQRQDEFR--WRQSPMELSSA 124
            .:.:|::.  ||:|:|.   .|||..:                       |:  ......::::.
plant    83 RSFILSFLKSSSTEETNAIFHELASVV-----------------------FKDGSETGGPKIAAV 124

  Fly   125 NRIFVDRTINVSNKFNTLLYGATK----ELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEIT 185
            |.::::::::.:..:..|.....|    ::||::..|....::|.|.:..|::.|:::|....:|
plant   125 NGVWMEQSLSCNPDWEDLFLNFFKASFAKVDFRHKAEEVRLDVNTWASRHTNDLIKEILPRGSVT 189

  Fly   186 PHTMLVLANAAYMKGQWLSQFKVEETALKPF-FINEREQEMVYMMHKTGAFKMTIDEGLQSQIIK 249
            ..|..:..||.|.||.|...|....|..||| .:|.:...:.:|......|....| |.  ::::
plant   190 SLTNWIYGNALYFKGAWEKAFDKSMTRDKPFHLLNGKSVSVPFMRSYEKQFIEAYD-GF--KVLR 251

  Fly   250 LPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQ-KIELS 313
            ||||.         ...::..:.||.:.||: .|..|:.::.|:.::  ..:.:..:|: ::::.
plant   252 LPYRQ---------GRDDTNREFSMYLYLPD-KKGELDNLLERITSN--PGFLDSHIPEYRVDVG 304

  Fly   314 ---LPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAA 375
               :|||:.|           .|    |..::.|.|...: :||     ...|.|::||.|:.||
plant   305 DFRIPKFKIE-----------FG----FEASSVFNDFELN-VSL-----HQKALIEIDEEGTEAA 348

  Fly   376 AATILLVSRSSRQPDPTK---FNCNHPFVFLIYDEKVDTILFAGVYSDPRQM 424
            |||.::|...|...:|.|   |..:|||:|||.::|..|:||||...||.::
plant   349 AATTVVVVTGSCLWEPKKKIDFVADHPFLFLIREDKTGTLLFAGQIFDPSEL 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 98/415 (24%)
SRP2NP_179060.1 SERPIN 36..397 CDD:294093 99/419 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.