DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpind1

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_077358.1 Gene:Serpind1 / 79224 RGDID:619854 Length:479 Species:Rattus norvegicus


Alignment Length:410 Identity:106/410 - (25%)
Similarity:185/410 - (45%) Gaps:49/410 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 QIFKGE----------RDFSLALMKQIR-EIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQ 86
            |:|:|:          ..|:..|.:.:: :...|.|:|.:|.....|:.:.......:|..|:..
  Rat    95 QLFQGKSRIQRLNILNAKFAFNLYRVLKDQATSSDNIFIAPVGISTAMGMISLGLRGETHEEVHS 159

  Fly    87 ALNLGWALN---KQQVLVSYTLAQRQDE--FRWRQSPMELSSANRIFVDRTINVSNKFNTLL--- 143
            .|:....:|   |.:|...:.|.::...  || |.....|.|.|.:::.:...:...|...:   
  Rat   160 VLHFKDFVNASSKYEVTTIHNLFRKLTHRLFR-RNFGYTLQSVNDLYIQKQFPIREDFKAAMREF 223

  Fly   144 -YGATKELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFK 207
             :...:|.|| :|| ..:.:.|..|...|...|::.|  |.....|.:::.|..|.||.|:::|.
  Rat   224 YFAEAQEADF-SDP-AFISKANSHILKLTKGLIKEAL--ENTDSATQMMILNCIYFKGAWMNKFP 284

  Fly   208 VEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDI 272
            ||.|....|.:||||...|.||...|.|....|:.|...|::|.|                ...|
  Rat   285 VEMTHNHNFRLNEREVVKVSMMQTKGNFLAANDQELDCDILQLEY----------------VGGI 333

  Fly   273 SMIIILPNSNKIS-LNRVISRLNADSVKKWFERALPQKIELSLPKFQFEQRLELTPILSLMGVNT 336
            ||:|::|  .|:| :..:.::|....|::|.:....:..|:.||||:.|:...|..:|..||:..
  Rat   334 SMLIVIP--RKLSGMKTLEAQLTPQVVERWQKSMTNRTREVLLPKFKLEKNYNLVEVLKSMGITK 396

  Fly   337 MFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFV 401
            :|.:|.....::...|  :||..:|.:.|.|:|.|:.|||.|.:.....|.|   .:|..:.||:
  Rat   397 LFNKNGNMSGISDQRI--IIDLFKHQSTITVNEEGTQAAAVTTVGFMPLSTQ---VRFTVDRPFL 456

  Fly   402 FLIYDEKVDTILFAGVYSDP 421
            ||:|:.:...:||.|..::|
  Rat   457 FLVYEHRTSCLLFMGRVANP 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 103/401 (26%)
Serpind1NP_077358.1 HCII 44..477 CDD:239002 106/410 (26%)
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 55..79
Glycosaminoglycan-binding site. /evidence=ECO:0000250 172..192 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.