DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and zgc:174259

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:XP_021331992.1 Gene:zgc:174259 / 791587 ZFINID:ZDB-GENE-080213-10 Length:410 Species:Danio rerio


Alignment Length:436 Identity:115/436 - (26%)
Similarity:189/436 - (43%) Gaps:83/436 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LDKPELSFLNEFSQIFKGERDFSLALMKQIREI--YPSGNLFFSPFSTYNALLLAYFSSSEQTER 82
            |.:|.:|  .:...:.....||:..|.|::.|.  |.|.|:||||||...||       ||    
Zfish    24 LQQPPIS--AKLPSLINMNNDFAFHLYKRLIESPDYQSKNIFFSPFSVSMAL-------SE---- 75

  Fly    83 ELAQALNLG-WALNKQQVL--VSYTLA--QRQDEFRWRQSPMELSSANRIFVDRTINVSNKFNTL 142
                 |:|| ....|||:|  :.|:.|  ..::..:...|.:| ...||..||  |:|    .|.
Zfish    76 -----LSLGAGGDTKQQLLSGIGYSSAIFSTEEMHQLFHSLLE-DIGNRTGVD--IDV----GTA 128

  Fly   143 LYGATK--------------------ELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPH 187
            ||.:.:                    .:|| :..|| :.:||.::.:|||.:|...:  :::...
Zfish   129 LYASDRFKPHSKFLEDMKEFYHSDGFTVDF-SVKET-VDQINKYVEEKTHGKINQAV--DDLDAD 189

  Fly   188 TMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPY 252
            |.:||....|.||:|...|..:.|:...|.|:::....|.|||:....|:..|..|.::::.|.|
Zfish   190 TFMVLLTYIYFKGKWDKPFNPKTTSESTFHIDDKTTVPVQMMHQYERLKVYYDAELSTKVLCLDY 254

  Fly   253 RTIYKSKETHISTPESKSDISMIIILPNSNK-----ISLNRVISRLNADSVKKWFERALPQKIEL 312
                            ....||.:.:|:.:.     ..|...:||   ..|:||......:|:::
Zfish   255 ----------------NDSFSMFLAVPDVHMGRKTIKDLEMTVSR---QHVEKWRRSVSERKVDI 300

  Fly   313 SLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAA 377
            .:||...:....|..||..||:..||:..|.|..::.:.|  .:....|.|.:.:||.|:||||.
Zfish   301 YVPKLSLKTSYSLKDILKGMGMADMFSDKADFTGVSEEKI--YVSKVLHKATLDIDEKGTTAAAV 363

  Fly   378 TILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDPRQ 423
            |.:.:...|..| .:..:.:.||:..|.|:..|.|||.|...:|.:
Zfish   364 TTVHLRFMSYSP-MSDLSFDRPFMIFITDQTNDNILFVGKVVNPNE 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 111/412 (27%)
zgc:174259XP_021331992.1 alpha-1-antitrypsin_like 39..403 CDD:239011 111/412 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.