DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpina9

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001348839.1 Gene:Serpina9 / 71907 MGIID:1919157 Length:418 Species:Mus musculus


Alignment Length:420 Identity:107/420 - (25%)
Similarity:182/420 - (43%) Gaps:66/420 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQAL--NLG 91
            |..||:......||..|.:::.:..|..|:.|||.|...:|.:....:...|:.::.:.|  |..
Mouse    41 NPASQVSPSNTRFSFLLYQRLAQENPGQNILFSPVSISTSLAMLSLGARSATKTQILRTLGFNFT 105

  Fly    92 W---------------ALNK----QQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSN 137
            |               :|||    :::.:...|..|::        ::|.:.   |:||.     
Mouse   106 WVSEPTIHMGFEYLVRSLNKCHQGRELRMGSVLFIRKE--------LQLQAT---FLDRV----- 154

  Fly   138 KFNTLLYGA-TKELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQ 201
               ..|||| ....||.| ..|...:||.::..:|..::.|::  :::...|.:||.|..:.|..
Mouse   155 ---KKLYGAKVFSEDFSN-AATAQAQINSYVEKETKGKVVDVI--QDLDSQTAMVLVNHIFFKAN 213

  Fly   202 WLSQFKVEETALK-PFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHIST 265
            |...|....|... ||.:::.....|.|||:|.:|...:|:.|...|:::.||            
Mouse   214 WTQPFSTANTNKSFPFLLSKGTTVHVPMMHQTESFAFGVDKELGCSILQMDYR------------ 266

  Fly   266 PESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQK-IELSLPKFQFEQRLELTPIL 329
                .|.....:||...|  :.::...|:|..::|| .|:|.:: |::.:|||.......|..||
Mouse   267 ----GDAVAFFVLPGKGK--MRQLEKSLSARRLRKW-SRSLQKRWIKVFIPKFSISASYNLETIL 324

  Fly   330 SLMGVNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKF 394
            ..||:...|..||.|..:|.... |.:..|.|.|.:.|.|.|:.|||||...:...||....:..
Mouse   325 PKMGIRDAFNSNADFSGITKTHF-LQVSKAAHKAVLDVSEEGTEAAAATTTKLIVRSRDTPSSII 388

  Fly   395 NCNHPFVFLIYDEKVDTILFAGVYSDPRQM 424
            ....||:.|:.|:..:::||.|...:||:|
Mouse   389 AFKEPFLILLLDKNTESVLFLGKVENPRKM 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 101/404 (25%)
Serpina9NP_001348839.1 alpha-1-antitrypsin_like 49..412 CDD:239011 101/404 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.