DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and SERPING1

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_000053.2 Gene:SERPING1 / 710 HGNCID:1228 Length:500 Species:Homo sapiens


Alignment Length:402 Identity:98/402 - (24%)
Similarity:177/402 - (44%) Gaps:69/402 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DFSLAL------MKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALN-KQ 97
            ||||.|      ||::..     |:.|||||..:.|......:.|.|:..|...|:...... ..
Human   148 DFSLKLYHAFSAMKKVET-----NMAFSPFSIASLLTQVLLGAGENTKTNLESILSYPKDFTCVH 207

  Fly    98 QVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKF---NTLLYGATKELDFKNDPETG 159
            |.|..:|             ...::|.::||....:.:.:.|   :..||.::..: ..|:.:..
Human   208 QALKGFT-------------TKGVTSVSQIFHSPDLAIRDTFVNASRTLYSSSPRV-LSNNSDAN 258

  Fly   160 LKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQE 224
            |:.||.|:|..|:|:|..:|.|  :...|.|||.||.|:..:|.:.|..::|.::||.......:
Human   259 LELINTWVAKNTNNKISRLLDS--LPSDTRLVLLNAIYLSAKWKTTFDPKKTRMEPFHFKNSVIK 321

  Fly   225 MVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRV 289
            :..|..|.......||:.|::::.:|                :...::|::|::|.:.|..|..:
Human   322 VPMMNSKKYPVAHFIDQTLKAKVGQL----------------QLSHNLSLVILVPQNLKHRLEDM 370

  Fly   290 ISRLNADSVKKWFERALPQKIELSLPKFQ----FEQRLELTPILSLMGVNTM-----FTRNATFG 345
            ...|:....|     |:.:|:|:|  |||    ...|:::|....::.:...     |:.:....
Human   371 EQALSPSVFK-----AIMEKLEMS--KFQPTLLTLPRIKVTTSQDMLSIMEKLEFFDFSYDLNLC 428

  Fly   346 DLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVD 410
            .||.|| .|.:...||...:::.|.|..||||:.:.|:|:.     ..|....||:|:::|::..
Human   429 GLTEDP-DLQVSAMQHQTVLELTETGVEAAAASAISVARTL-----LVFEVQQPFLFVLWDQQHK 487

  Fly   411 TILFAGVYSDPR 422
            ..:|.|...|||
Human   488 FPVFMGRVYDPR 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 95/396 (24%)
SERPING1NP_000053.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..43
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..118
7 X 4 AA tandem repeats of [QE]-P-T-[TQ] 85..119
C1_inh 145..495 CDD:239005 95/396 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.