DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpina1f

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_080963.2 Gene:Serpina1f / 68348 MGIID:1915598 Length:411 Species:Mus musculus


Alignment Length:404 Identity:73/404 - (18%)
Similarity:152/404 - (37%) Gaps:68/404 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLG-------------WA 93
            |:.|.|::.::..:||:.|||.....|:.:....|:....:.:.:.|...             |.
Mouse    52 SITLFKKMAQLSGNGNILFSPIRVIAAISMLSLGSNGNLSKHILETLRFNKTGLPEAEIHKCFWY 116

  Fly    94 LNKQQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKF----NTLLYGATKELDFKN 154
            |       .:::.|.::       |..|.:.:.:|:.:.:...:||    ..|.:.....::| .
Mouse   117 L-------LHSIHQTEE-------PSSLQTGSSVFIHQDLTSVDKFVKGVKDLYHSDMISINF-T 166

  Fly   155 DPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFIN 219
            |......:||:::.:|:..:|.:::.:.|  ..|.|.:.|......:..|.|......:|.:.:.
Mouse   167 DSSQAKTQINNYVMEKSQKEIVNIVKNLE--SDTFLAVVNYIIWNAKLDSNFGCRSVKVKDYHLG 229

  Fly   220 EREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKI 284
            ......|.|:|......:...|.|.|.::.|...|               .:.:...|:|:..| 
Mouse   230 YGMTIKVPMIHNMAMHYLFRVEDLSSTVLMLTLLT---------------GNFATYFIIPDPGK- 278

  Fly   285 SLNRVISRLNADSVKKWFERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTA 349
             :.:|...|.....::...:.|.:.::|.:|:....:..:|..::||:|:..:|.......|:. 
Mouse   279 -MQKVEQSLTYPHFRRMRRQLLTRLVDLEIPELSLSETHDLESMMSLLGITYVFNSGTNSSDMN- 341

  Fly   350 DPISLVIDDAQHLAKI------KVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEK 408
                   |..|...|:      .:||.||..:..:..   :.....|..:...|.||:..|.|..
Mouse   342 -------DTLQKSFKVVSKAVLTIDEKGSKPSTNSCF---KKLGSTDMGRMQLNRPFLIFIQDHT 396

  Fly   409 VDTILFAGVYSDPR 422
            .|..||.|...:|:
Mouse   397 NDVPLFLGRVVNPQ 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 72/398 (18%)
Serpina1fNP_080963.2 Serpin 48..409 CDD:278507 72/401 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.