DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpina12

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_080811.1 Gene:Serpina12 / 68054 MGIID:1915304 Length:413 Species:Mus musculus


Alignment Length:436 Identity:109/436 - (25%)
Similarity:203/436 - (46%) Gaps:56/436 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LALLPVVTIAAL----DKPELSFLNEFSQIFKGERD----------FSLALMKQIREIYPSGNLF 59
            |.|..::|:..|    |.|::.......|.::|::|          |...|::::....|.||:|
Mouse     9 LFLAGLLTVKGLLQDRDAPDMYDSPVRVQEWRGKKDARQLARHNMEFGFKLLQRLASNSPQGNIF 73

  Fly    60 FSPFSTYNALLLAYFSSSEQTERELAQALNL----GWALNKQQVLVSYTLAQRQDEFRWRQSPME 120
            .||.|...|..:....:...|..|:.:..|.    .|.::.....:.:.|.|..::       .:
Mouse    74 LSPLSISTAFSMLSLGAQNSTLEEIREGFNFKEMSNWDVHAAFHYLLHKLNQETED-------TK 131

  Fly   121 LSSANRIFVDRTINVSNKFNTL---LYGATKELDFKNDPETGLKEINDWIADKTHNQIRDMLSSE 182
            ::..|.:|:|:.:....:|..|   :|.|...|....|.|...|:||.:|:.|||::|::|:.| 
Mouse   132 MNLGNALFMDQKLRPQQRFLNLAKNVYDADMVLTNFQDLENTQKDINRYISQKTHSRIKNMVKS- 195

  Fly   183 EITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQI 247
             |.|.|:::|.|..|.:|:|..:|..::|..:.|||.:.:...|.||.:.|.:.|..|..|...|
Mouse   196 -IDPGTVMILTNYIYFRGRWQYEFDPKQTKEEEFFIEKGKTVKVPMMFQRGLYDMAYDSQLSCTI 259

  Fly   248 IKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKIEL 312
            :::|||                .:|:...:||::.|:.|  :...|.||...||......:.:::
Mouse   260 LEIPYR----------------GNITATFVLPDNGKLKL--LEQGLQADIFAKWKSLLSKRVVDV 306

  Fly   313 SLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLT--ADPISLVIDDAQHLAKIKVDEVGSTAA 375
            .:||.:......:..:||.:|::.:|..|   ||||  :...||.:.:|.|.|::|:||.|...|
Mouse   307 WVPKLRISSTYNMKKVLSRLGISKIFEEN---GDLTRISSHRSLKVGEAVHKAELKMDEKGMEGA 368

  Fly   376 AATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDP 421
            |.:   .:::.....|.....:.||:.:||:..:.:::|.....||
Mouse   369 AGS---GAQTLPMETPRHMKLDRPFLMMIYENFMPSMVFLARIYDP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 100/399 (25%)
Serpina12NP_080811.1 alpha-1-antitrypsin_like 51..408 CDD:239011 98/389 (25%)
Reactive center loop. /evidence=ECO:0000250|UniProtKB:Q8IW75 364..382 3/20 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.