DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpini2

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_080736.2 Gene:Serpini2 / 67931 MGIID:1915181 Length:405 Species:Mus musculus


Alignment Length:425 Identity:116/425 - (27%)
Similarity:200/425 - (47%) Gaps:65/425 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SFLNEFSQIFKGER----------DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQT 80
            :.|..|...|.|.:          ||::.|.|.| .:....|:.|||..|...|.:....:..:.
Mouse     4 TILWSFLLFFSGSQTSRATDQKIADFAVDLYKAI-SLSHKNNIIFSPLGTTMLLGMVQLGAKGKA 67

  Fly    81 ERELAQALNL-GWALNKQ-QVLVSY--TLAQRQDEFRWRQSPMELSSA----NRIFVDRTINVSN 137
            ::::.:.|.: |....:: .||.|.  .:::::.||.:     .|:||    ....|..|...||
Mouse    68 QQQILKTLRMRGTPAGEEFSVLKSLFSAISKKKQEFTF-----NLASALYLQEGFIVKETYLHSN 127

  Fly   138 KFNTLLYGATKELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQW 202
            |  .....|||.:||. |.:|..:.|:.|:..||..:|::|.|.||..|.|.|||.||.|.||.|
Mouse   128 K--EFFQSATKLVDFL-DAKTSAQAISTWVESKTDGKIKNMFSEEEFGPLTRLVLVNAIYFKGDW 189

  Fly   203 LSQFKVEETALKPFFINEREQEMVYMMH-----KTGAFKMTIDEGLQSQIIKLPYRTIYKSKETH 262
            ..:|:.|:|.:..|...:.....|.||.     :.|.|..:   .:..|:::|||:.        
Mouse   190 KQKFRKEDTEMTDFTKKDGSTVKVPMMKALLRAQYGYFSQS---SMTCQVLELPYKA-------- 243

  Fly   263 ISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKIELSLPKFQFEQRLELTP 327
                   .:.|::||||..: .|:..|.:::.|..|::||.....:::|:|||:|:.||:|:|..
Mouse   244 -------DEFSLVIILPTED-TSIEEVENQVTAPHVRRWFSELHEEEVEVSLPRFKIEQKLDLKE 300

  Fly   328 ILSLMGVNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAAT------ILLVSRSS 386
            .|..:.|..:|:.......:| |...:.:.........:::|.||.|||:|      |:.:::  
Mouse   301 ALYSLNVTEIFSGGCDLSGIT-DSSEVYVSRVMQKVFFEINEDGSEAAASTGINIPAIMSLTQ-- 362

  Fly   387 RQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDP 421
                 |:|..||||:|::...:.::|||.|..:||
Mouse   363 -----TQFLANHPFLFILKHIRTESILFMGKVTDP 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 111/409 (27%)
Serpini2NP_080736.2 neuroserpin 23..405 CDD:239003 112/406 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.