DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and SERPINB4

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_002965.1 Gene:SERPINB4 / 6318 HGNCID:10570 Length:390 Species:Homo sapiens


Alignment Length:415 Identity:119/415 - (28%)
Similarity:201/415 - (48%) Gaps:46/415 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGW 92
            :|..|:   ....|...|.:|.|: ....|:|:||.|..:||.:....:.:.|.:::::.|:...
Human     1 MNSLSE---ANTKFMFDLFQQFRK-SKENNIFYSPISITSALGMVLLGAKDNTAQQISKVLHFDQ 61

  Fly    93 AL-NKQQVLVSYTLAQRQD----------EFRWRQSPMELSSANRIFVDRT-------INVSNKF 139
            .. |..:...:|.:.:..:          ||.......||..||::|.::|       ::...||
Human    62 VTENTTEKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYQFLQEYLDAIKKF 126

  Fly   140 NTLLYGATKE-LDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWL 203
                |..:.| .||.|.||...|:||.|:..:|:.:|:::.....|...|.|||.||.|.||||.
Human   127 ----YQTSVESTDFANAPEESRKKINSWVESQTNEKIKNLFPDGTIGNDTTLVLVNAIYFKGQWE 187

  Fly   204 SQFKVEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPES 268
            ::||.|.|..:.|:.|:...:.|.||.:..:|...:.|.:|::::::|    ||.|         
Human   188 NKFKKENTKEEKFWPNKNTYKSVQMMRQYNSFNFALLEDVQAKVLEIP----YKGK--------- 239

  Fly   269 KSDISMIIILPNSNKISLNRVISRLNADSVKKW--FERALPQKIELSLPKFQFEQRLELTPILSL 331
              |:|||::|||... .|.::..:|.|:.:.:|  .:......::|.||:|:.|:..:|...|..
Human   240 --DLSMIVLLPNEID-GLQKLEEKLTAEKLMEWTSLQNMRETCVDLHLPRFKMEESYDLKDTLRT 301

  Fly   332 MGVNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNC 396
            ||:..:|..:|....:|... .|.:....|.|.::|.|.|..|||||.::|...|......:|.|
Human   302 MGMVNIFNGDADLSGMTWSH-GLSVSKVLHKAFVEVTEEGVEAAAATAVVVVELSSPSTNEEFCC 365

  Fly   397 NHPFVFLIYDEKVDTILFAGVYSDP 421
            ||||:|.|...|.::|||.|.:|.|
Human   366 NHPFLFFIRQNKTNSILFYGRFSSP 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 115/401 (29%)
SERPINB4NP_002965.1 SERPIN 4..390 CDD:320777 117/410 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.