DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpina3i

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:XP_017170641.1 Gene:Serpina3i / 628900 MGIID:2182841 Length:457 Species:Mus musculus


Alignment Length:411 Identity:102/411 - (24%)
Similarity:184/411 - (44%) Gaps:59/411 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQ------- 97
            ||:.:|.:::....|..|:.|||||.:.||.|....:...|.:|:.:.|........:       
Mouse    78 DFAFSLYRKLVLKNPDENVVFSPFSIFTALALLSLGAKSNTLKEILEGLKFNLTETPEPDIHQGF 142

  Fly    98 QVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFN---TLLYGATK-ELDFKNDPET 158
            :.|:. .|:|..|:       :::|:.:.:||::.:.:..:|.   ..||.|.. ..||. .|..
Mouse   143 RYLLD-LLSQPGDQ-------VQISTGSALFVEKHLQILAEFKEKARALYQAEAFTADFL-QPCQ 198

  Fly   159 GLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMK--------------GQWLSQFKVE 209
            ..|.|||:::::|..:|::::|  ::...|::||.|..|.|              |:|...|...
Mouse   199 AKKLINDYVSNQTQGKIKELIS--DLDKSTLMVLVNYIYFKGGRGHCLGVEREELGKWKMPFDPR 261

  Fly   210 ETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESK--SDI 272
            :|....|:::|:....|.|        |.|:|      :..||   ::..|...|..|.|  .:.
Mouse   262 DTFNSKFYLDEKRSVKVPM--------MKIEE------LTTPY---FRDDELSCSVVELKYTGNA 309

  Fly   273 SMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKI-ELSLPKFQFEQRLELTPILSLMGVNT 336
            |.:.|||:..|  :.:|.:.|:.::::||.....|.:| ||.||||.......|..:|.::|:..
Mouse   310 SALFILPDQGK--MQQVETSLHPETLRKWKNSLKPSRISELHLPKFSISNDYSLEHVLPVLGIRE 372

  Fly   337 MFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFV 401
            :|:..|....:|. .:.|.:....|.|.:.|.|.|:.|||||.:.|:....:..........||:
Mouse   373 VFSMQADLSAITG-TMDLRVSQVVHKAVLDVTETGTEAAAATGVKVNLRCGKIYSMTIYFKRPFL 436

  Fly   402 FLIYDEKVDTILFAGVYSDPR 422
            .:|.|......||....::|:
Mouse   437 IIISDINTHIALFMAKVTNPK 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 101/405 (25%)
Serpina3iXP_017170641.1 serpinA3_A1AC 62..457 CDD:381019 101/409 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.