DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpinb2

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_067728.1 Gene:Serpinb2 / 60325 RGDID:621823 Length:416 Species:Rattus norvegicus


Alignment Length:441 Identity:112/441 - (25%)
Similarity:193/441 - (43%) Gaps:70/441 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQAL 88
            |||..|..         |:|.|:|||.:...:.|:|.||:|..:.|.:.:..:...||.::|:.|
  Rat     3 ELSMANTM---------FALNLLKQIEQSNSTQNIFISPWSISSTLAIVFLGAQANTEEQMAKVL 58

  Fly    89 N---------------------LGWALNKQQVLVSYTLAQRQDEFRWRQSPME------------ 120
            |                     ....:.:....|:...||.:|:.....|.:.            
  Rat    59 NFDKIGSYDLTPGNPENFHGCDFAQHIQRDNYPVAILQAQARDKIHSAFSSLSSTINTPRLGDYL 123

  Fly   121 LSSANRIFVDRTINVSNKF--NTLLYGAT--KELDFKNDPETGLKEINDWIADKTHNQIRDMLSS 181
            |.|||::|.:::.....::  ....|.:|  :.:||........|:||.|:..:|..:|.::|..
  Rat   124 LESANKLFGEKSARFKEEYIQRCKKYYSTEPEAVDFLECANEARKKINSWVKTQTKGEIPNLLPE 188

  Fly   182 EEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQ 246
            ..:...|.:||.|..|.||:|.:.|:.....|.||.:|..|.:.|.||:......:...:.|::|
  Rat   189 GSVDEDTKMVLVNTIYFKGRWKTPFQKRLNGLYPFRVNLNESKPVQMMYLREKLNIGYIKDLKTQ 253

  Fly   247 IIKLPYRTIYKSKETHISTPESKSDISMIIILPN---SNKISLNRVISRLNADSVKKWFERAL-- 306
            |::|||                ..:|||.::||:   .:...|..:...:|.|:..||..:..  
  Rat   254 ILELPY----------------IGNISMFLLLPDEIEDSSTGLEMLEREINFDNFNKWISKETLD 302

  Fly   307 PQKIELSLPKFQFEQRLELTPILSLMGVNTMFTR-NATFGDLTADPISLVIDDAQHLAKIKVDEV 370
            ...:.:.:|||:..|..||.|||..||:...|.: .|.|..: ::...|.:.:..|.|.:.|:|.
  Rat   303 EDDVLVYIPKFKLAQNYELKPILQRMGMEDAFNKGKADFSGM-SESNDLFLSEVFHQATVDVNEE 366

  Fly   371 GSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDP 421
            |:.||..|..:::..:....| :|..:|||:|.|.:....||||.|.:|.|
  Rat   367 GTVAAGGTGAVMTGRTGHGGP-QFVADHPFLFFIMNNITRTILFVGRFSSP 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 106/423 (25%)
Serpinb2NP_067728.1 serpinB2_PAI-2 2..416 CDD:381029 111/439 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.