DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and LOC569077

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001188383.1 Gene:LOC569077 / 569077 -ID:- Length:384 Species:Danio rerio


Alignment Length:405 Identity:116/405 - (28%)
Similarity:184/405 - (45%) Gaps:56/405 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYTL 105
            |:|.|.:.:......||:||||.|....|.:.|..:...|..|:.:.|:|.        .||...
Zfish    11 FALDLYQALSASSAEGNIFFSPLSISAVLSMVYLGARGDTAAEMERVLSLS--------SVSDVH 67

  Fly   106 AQRQDEFRWRQSPME---LSSANRIFVDRTIN----VSNKFNTLLYGATKELDFKNDPETGLKEI 163
            :..:.......||..   |..|||::.:::.:    ..:....|.:...:.:||....|...:.|
Zfish    68 SHFESLISSINSPSASYILRLANRLYGEKSFSFLPECLDSTMKLYHAELQTVDFIGASEGSRQLI 132

  Fly   164 NDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYM 228
            |.|:..:|.|:|||:|....:|..|.|.|.||.|.||:|...|:.:.|....|.||::|...|.|
Zfish   133 NKWVEKQTENKIRDLLKPGMVTTMTRLALVNAIYFKGKWTHTFQAKYTREMAFKINQKESHPVRM 197

  Fly   229 MHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKIS---LNRVI 290
            ||               |:.|||:|.:.:.|...:..|..:.::||:|:||:..|..   |.::.
Zfish   198 MH---------------QLNKLPFRCLPEYKLQVLELPYIQQELSMLILLPDETKDGSDPLLKLE 247

  Fly   291 SRLNADSVKKWFERALPQKIE------LSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTA 349
            ..|..:.:..|..|   .|::      :.||||:.|....|:..|..||::::|  ..|..|||.
Zfish   248 KELTLEKLLDWTNR---DKMDTQGAVIVHLPKFKLEIESCLSETLEKMGMSSVF--QETKADLTG 307

  Fly   350 DP------ISLVIDDAQHLAKIKVDEVGSTAAAAT-ILLVSRSSRQPDPT-KFNCNHPFVFLIYD 406
            ..      :|.||    |.|.:.|.|.|:.||||| :.:::....:|:|. .|..:|||:|.|..
Zfish   308 MGSNGGLFVSAVI----HKAFVDVSEEGTEAAAATCVYIITSYVPRPEPRYYFTADHPFMFFIRH 368

  Fly   407 EKVDTILFAGVYSDP 421
            ...:.|||.|.|..|
Zfish   369 NPSNNILFLGRYRSP 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 114/400 (29%)
LOC569077NP_001188383.1 SERPIN 5..383 CDD:294093 115/403 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.