DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and serpinb1l2

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001038636.1 Gene:serpinb1l2 / 568898 ZFINID:ZDB-GENE-041001-117 Length:382 Species:Danio rerio


Alignment Length:404 Identity:121/404 - (29%)
Similarity:188/404 - (46%) Gaps:56/404 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYTL 105
            |:|.|.:.:......||:||||.|...||.:.|..:...|..|:            ::||...::
Zfish    11 FALDLYRALSASSAEGNIFFSPLSISAALSMVYLGARGDTAGEM------------EKVLCFSSV 63

  Fly   106 AQRQDEFRWRQSPME-------LSSANRIFVDRTINVSNKF--NTL-LYGATKE-LDFKNDPETG 159
            :.....|:...|.:.       |..|||::.::|.:....:  :|: ||.|..: :||....:..
Zfish    64 SDFHAHFKTLISSINSPSASYILRLANRLYGEKTFSFLPMYVDSTMKLYHAEPQTVDFIRAADDS 128

  Fly   160 LKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQE 224
            .:.||.|:..:|.|||:|:|....:...|.|:|.||.|.||.|:..|....|...||.||:.|..
Zfish   129 RQFINKWVEKQTENQIKDLLQPGVVNEMTRLLLVNAIYFKGNWMHTFDAHATKEMPFKINQNESR 193

  Fly   225 MVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKIS---L 286
            .|.||               .|:...|||.|.:.|...:..|.::.::||:|:||:..|..   |
Zfish   194 PVQMM---------------DQVENFPYRCIPEYKLQVLELPYTQQELSMLILLPDEIKYGSDPL 243

  Fly   287 NRVISRLNADSVKKWFERALP---QKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLT 348
            .::.|.||...:..|..|...   :||.:.||||:.|....|:..|..||::::|  ..|..|||
Zfish   244 LKLESELNLQKLLDWTSRGKMDTWRKIIVRLPKFKLEIESCLSETLEKMGMSSVF--QETKADLT 306

  Fly   349 ADP------ISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDE 407
            ...      :|.||    |.|.::|:|.|:.|||||.||:..|:.|.....|..:|||:|.|...
Zfish   307 GMSSNGGLFLSAVI----HKAFVEVNEEGTEAAAATALLLPISACQGAFHDFIADHPFMFFIRHN 367

  Fly   408 KVDTILFAGVYSDP 421
            ..::|||.|.:..|
Zfish   368 PTNSILFLGRFRAP 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 120/399 (30%)
serpinb1l2NP_001038636.1 SERPIN 5..381 CDD:294093 120/402 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.