DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and si:ch211-186e20.7

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:XP_021329695.1 Gene:si:ch211-186e20.7 / 566630 ZFINID:ZDB-GENE-110407-6 Length:410 Species:Danio rerio


Alignment Length:434 Identity:119/434 - (27%)
Similarity:189/434 - (43%) Gaps:79/434 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LDKPELSFLNEFSQIFKGERDFSLALMKQIREI--YPSGNLFFSPFSTYNALLLAYFSSSEQTER 82
            |.:|.:|  .:...:.....||:..|.|::.|.  |.|.|:||||||...||       ||    
Zfish    24 LQQPPIS--AKLPSLINMNNDFAFHLYKRVIESPDYQSKNIFFSPFSVSIAL-------SE---- 75

  Fly    83 ELAQALNLG-WALNKQQVL--VSY--TLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFNTL 142
                 |:|| ....|||:|  :.|  |....::..:...|.:| ...||..||  |:|    .|.
Zfish    76 -----LSLGAGGDTKQQLLSGIGYNSTTFSTEEMHQLFHSLLE-DIGNRTGVD--IDV----GTA 128

  Fly   143 LYGATK--------------------ELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPH 187
            ||.:.:                    .:||: ..|| :.:||::...||..:....:  :::...
Zfish   129 LYASDRFKPHSKFLEDMKEFYHSDGFTVDFR-VKET-VDQINNYAKKKTQGKFNQAV--DDLEED 189

  Fly   188 TMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPY 252
            |::.|....|.||:|...||.|:|....|.|:::....|.|||:....|:..|..|.::::.|.|
Zfish   190 TLMFLLTYIYFKGKWDKPFKPEKTRESTFHIDDKTTVPVQMMHQYERLKVFYDAELSTKVLCLDY 254

  Fly   253 RTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKIELSLPKF 317
            :   .|....::.|:.|        :.:.|...|...:||   ...:||...|..:.:::.:||.
Zfish   255 K---DSFSMFLAVPDDK--------MEHKNIKDLEMTVSR---QHFEKWRRSAFKKTVDIYVPKL 305

  Fly   318 QFEQRLELTPILSLMGVNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLV 382
            ..:....|..||..||:..||:..|.|..::.:.|  .:....|.|.:.:||.|:||||.|  .|
Zfish   306 SLKTSYSLKDILKGMGMADMFSDKANFTGVSEEKI--FVSKVLHKATLDIDEQGTTAAAVT--GV 366

  Fly   383 SRSSRQPDP---TKFNCNHPFVFLIYDEKVDTILFAGVYSDPRQ 423
            |...|..:|   .||  |.||:..|.|:..|.|||.|...:|.:
Zfish   367 SMRVRLHNPLSILKF--NRPFMVFITDQTNDNILFFGKVVNPNE 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 115/410 (28%)
si:ch211-186e20.7XP_021329695.1 alpha-1-antitrypsin_like 39..403 CDD:239011 115/410 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.