DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and serpinh1a

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001103844.1 Gene:serpinh1a / 555328 ZFINID:ZDB-GENE-080219-21 Length:403 Species:Danio rerio


Alignment Length:436 Identity:98/436 - (22%)
Similarity:181/436 - (41%) Gaps:63/436 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SLVLLALLPVV----------TIAALDKPELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLF 59
            :::||.||..|          |..|.:...|:| |.:..:.| ::|..              |:.
Zfish     5 NVLLLCLLATVSANKTLSSIATTLADNSATLAF-NLYQNMAK-DKDIE--------------NIL 53

  Fly    60 FSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQ-----QVLVSYTLAQRQDEFRWRQSPM 119
            .||....::|.|........|..::...|:.....::|     ..|::.....:.....|:.|..
Zfish    54 ISPVVVASSLGLVALGGKSNTASQVKTVLSAASVKDEQLHSGLSELLTEVSNPKARNVTWKISNR 118

  Fly   120 ELSSANRIFVDRTINVSNK-FNTLLYGATKELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEE 183
            ....::..|||..:..|.| :|   |..:| ::|: |..:.:|.||||.:..|..::.::....|
Zfish   119 FYGPSSVSFVDDFLKSSKKHYN---YDHSK-INFR-DKRSAVKAINDWASKSTDGKLPEVTKDVE 178

  Fly   184 ITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQII 248
            .|...|::  ||.:.|..|..||..:....:.|.::......|.|||:||.:....|...:..::
Zfish   179 KTDGAMII--NAMFYKPHWNEQFHHKMVDNRGFLVHRSFTVSVPMMHRTGIYGFLDDTTNKLLVL 241

  Fly   249 KLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQK-IEL 312
            ::|.        .|..:       |:::|:|...: ||.||...|....:..|.. |:.|| :.:
Zfish   242 EMPL--------AHKMS-------SLVLIMPYHVE-SLERVEKLLTRQQLNTWVS-AMEQKAVAI 289

  Fly   313 SLPKFQFEQRLELTPILSLMGVNTMFTR-NATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAA 376
            ||||...|....|...|:.:|:.....: .|...:::... .|.:.:..|.:.::.|..|:....
Zfish   290 SLPKVSMEVSHNLQKHLAELGLTEAVDKAKADLSNISGKK-DLYLSNVFHASAMEWDTEGNPPDT 353

  Fly   377 ATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDPR 422
            :    :..:.:..:|..|..:||||||:.|.|.::|||.|....|:
Zfish   354 S----IFGTDQLKNPKLFYADHPFVFLVKDNKTNSILFMGRLIRPK 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 86/388 (22%)
serpinh1aNP_001103844.1 SERPIN 26..391 CDD:294093 92/409 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.