DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and serpind1

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001015716.1 Gene:serpind1 / 548433 XenbaseID:XB-GENE-6085731 Length:484 Species:Xenopus tropicalis


Alignment Length:414 Identity:109/414 - (26%)
Similarity:190/414 - (45%) Gaps:58/414 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 QIFKGE----------RDFSLALMKQIR-EIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQ 86
            ::|:|:          .:|...|.:.|: ....|.|:..:|.....|:......:..|.   |.|
 Frog   101 ELFQGKTRVQRLSIINANFGFNLYRAIKNNTDASDNILLAPVGISTAMATISLGTKGQA---LDQ 162

  Fly    87 AL-NLGW-----ALNKQQVLVSYTLAQRQDE--FRWRQSPMELSSANRIFVDRTINVSNKFNTLL 143
            .| .||:     |.:|.::|..:.:.::...  || |.....|.|.|.|:|.:...:...|...|
 Frog   163 VLFTLGFKNFINASSKYEILTLHNVFRKLTHRLFR-RNFGYTLRSVNDIYVKKDFVIREPFKNNL 226

  Fly   144 ----YGATKELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLS 204
                :...:.:||.:  :..|.:.|..|...|...|::.|::  :.|..:::|.|..|.||.|.:
 Frog   227 KNYYFAEAQMVDFGS--KDFLTKANKRIQQLTKGLIKEALTN--VDPALLMLLVNCIYFKGTWEN 287

  Fly   205 QFKVEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESK 269
            :|.||.|....|.:||:|...|.||...|.|.:..|..|...:::|||                .
 Frog   288 KFPVEYTQNMNFRLNEKELVKVPMMKTKGNFLVAADPELDCAVLQLPY----------------V 336

  Fly   270 SDISMIIILPNSNKISLNRVISR-LNADSVKKWFERALPQKIELSLPKFQFEQRLELTPILSLMG 333
            .:|||:|:||  :|:|..:::.: ::...|::|......:..|:.||:|:.|:...|..:||.||
 Frog   337 GNISMLIVLP--HKLSGMKLLEKQISPQVVERWQNIMTNRTREVFLPRFKLEKSYNLQEVLSNMG 399

  Fly   334 VNTMFTRNATFGDLT-ADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCN 397
            |..:||.    ||.: ....::.|...||...|.|:|.|:.|||.|::.....|.|   .:|..:
 Frog   400 VTDLFTH----GDFSGVSDKNMNIGLFQHQGTITVNEEGTEAAAVTVVGFMPLSTQ---ARFVAD 457

  Fly   398 HPFVFLIYDEKVDTILFAGVYSDP 421
            .||:||||:.:.:.::|.|..::|
 Frog   458 RPFLFLIYEHRTNCLIFMGRVANP 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 107/405 (26%)
serpind1NP_001015716.1 serpinD1_HCF2 38..484 CDD:381004 109/414 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.