DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and SERPINF2

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:XP_005256758.2 Gene:SERPINF2 / 5345 HGNCID:9075 Length:507 Species:Homo sapiens


Alignment Length:388 Identity:96/388 - (24%)
Similarity:175/388 - (45%) Gaps:47/388 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYTL 105
            |:..|...:.:.....||..||.|...||......:...|.:.|.|.|:.|     ....:.:.|
Human   105 FTADLFSLVAQTSTCPNLILSPLSVALALSHLALGAQNHTLQRLQQVLHAG-----SGPCLPHLL 164

  Fly   106 AQRQDEFRWRQSPMELSSANRIFVDRTINVSNKF---NTLLYGATKELDFKNDPETGLKEINDWI 167
            ::...:.    .|.....|.|:::.:...:...|   :..|:|| |.:......|..|..||.|:
Human   165 SRLCQDL----GPGAFRLAARMYLQKGFPIKEDFLEQSEQLFGA-KPVSLTGKQEDDLANINQWV 224

  Fly   168 ADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMH-K 231
            .:.|..:|::.||.  :...|:|:|.||.:.:|.|.::|....|....|.::|:....|.||. :
Human   225 KEATEGKIQEFLSG--LPEDTVLLLLNAIHFQGFWRNKFDPSLTQRDSFHLDEQFTVPVEMMQAR 287

  Fly   232 TGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNAD 296
            |...:..:.|..:.|:...|:                |:::|.::::|...:.::::|::.|:.|
Human   288 TYPLRWFLLEQPEIQVAHFPF----------------KNNMSFVVLVPTHFEWNVSQVLANLSWD 336

  Fly   297 SVKK---WFERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADPISLVIDD 358
            ::..   | ||  |.|:.  |||...:.:::|...||.:|:..:|......|   ....|||:..
Human   337 TLHPPLVW-ER--PTKVR--LPKLYLKHQMDLVATLSQLGLQELFQAPDLRG---ISEQSLVVSG 393

  Fly   359 AQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDP 421
            .||.:.:::.|||..|||||.:.:||.|.    :.|:.|.||:|.|:::.....||.|...:|
Human   394 VQHQSTLELSEVGVEAAAATSIAMSRMSL----SSFSVNRPFLFFIFEDTTGLPLFVGSVRNP 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 95/383 (25%)
SERPINF2XP_005256758.2 alpha2AP 98..449 CDD:239008 95/383 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.