DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and SERPINB13

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001294852.1 Gene:SERPINB13 / 5275 HGNCID:8944 Length:400 Species:Homo sapiens


Alignment Length:414 Identity:116/414 - (28%)
Similarity:202/414 - (48%) Gaps:65/414 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LMKQIREIYPSGNLFFSPFSTYNAL--------------LLAYFSSSEQT--------ERELAQA 87
            |.|::::. ..||:||||.....|:              |...|.|.::|        |:|:.:.
Human    15 LFKELKKT-NDGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSEKETKSSRIKAEEKEVVRI 78

  Fly    88 LNLGWALNKQQVLVSYTLAQRQDEFRWRQSPM----ELSSANRIFVDRTINVSNKFNTLL---YG 145
            ...|     :::..:..:.|:..:|....|.:    ||:..||:|.::|.....|:...:   |.
Human    79 KAEG-----KEIENTEAVHQQFQKFLTEISKLTNDYELNITNRLFGEKTYLFLQKYLDYVEKYYH 138

  Fly   146 ATKE-LDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVE 209
            |:.| :||.|..:...|:||.|:..||:.:|:|:.....|:..|.|||.|..|.||||..:||.|
Human   139 ASLEPVDFVNAADESRKKINSWVESKTNEKIKDLFPDGSISSSTKLVLVNMVYFKGQWDREFKKE 203

  Fly   210 ETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISM 274
            .|..:.|::|:...:.|.||.::.:|..|..|.||::|:.:||:               .:|:||
Human   204 NTKEEKFWMNKSTSKSVQMMTQSHSFSFTFLEDLQAKILGIPYK---------------NNDLSM 253

  Fly   275 IIILPNSNKISLNRVISRLNADSVKKWF------ERALPQKIELSLPKFQFEQRLELTPILSLMG 333
            .::|||... .|.::|.:::.:.:.:|.      ||    |:.|.||:|:.|...:|..:|:.||
Human   254 FVLLPNDID-GLEKIIDKISPEKLVEWTSPGHMEER----KVNLHLPRFEVEDGYDLEAVLAAMG 313

  Fly   334 VNTMFTRN-ATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCN 397
            :...|:.: |.:..:::.. .|......|.:.:.|.|.|:.|||||.:..:.:| .|.....:||
Human   314 MGDAFSEHKADYSGMSSGS-GLYAQKFLHSSFVAVTEEGTEAAAATGIGFTVTS-APGHENVHCN 376

  Fly   398 HPFVFLIYDEKVDTILFAGVYSDP 421
            |||:|.|...:.::|||.|.:|.|
Human   377 HPFLFFIRHNESNSILFFGRFSSP 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 114/409 (28%)
SERPINB13NP_001294852.1 SERPIN 4..400 CDD:294093 115/412 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.