DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and SERPINB9

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_004146.1 Gene:SERPINB9 / 5272 HGNCID:8955 Length:376 Species:Homo sapiens


Alignment Length:402 Identity:111/402 - (27%)
Similarity:188/402 - (46%) Gaps:57/402 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYTL 105
            |::.|:|.:.:..||.|:|.||.|..:||.:....:...|..::||||:|.              
Human    11 FAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLN-------------- 61

  Fly   106 AQRQDEFRWRQSPME----------LSSANRIFVDRTINVSNKFN----TLLYGATKELDFKNDP 156
             ..:|..|..||.:.          |.:|||:|.::|....:.|.    ...:...|||.|....
Human    62 -TEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAA 125

  Fly   157 ETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINER 221
            |...|.||.|::.||..:|.::|....|...|.|||.||.|.||:|...|....|...||.||:.
Human   126 EESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQE 190

  Fly   222 EQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISL 286
            ||..|.||::...||:.....:::|:::|||               ::.::|::::||:.. :.|
Human   191 EQRPVQMMYQEATFKLAHVGEVRAQLLELPY---------------ARKELSLLVLLPDDG-VEL 239

  Fly   287 NRVISRLNADSVKKWFERALPQ-----KIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGD 346
            :.|...|..:.:..|.:   |.     ::|:.||||:.::..::..:|..:|:...|.:..  .|
Human   240 STVEKSLTFEKLTAWTK---PDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGK--AD 299

  Fly   347 LTADPI--SLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKV 409
            |:|...  .|.:....|.:.::|:|.|:.||||:...|..........:|..:|||:|.|...:.
Human   300 LSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRA 364

  Fly   410 DTILFAGVYSDP 421
            ::|||.|.:|.|
Human   365 NSILFCGRFSSP 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 109/397 (27%)
SERPINB9NP_004146.1 SERPIN 4..376 CDD:320777 110/400 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.