DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and SERPINB6

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:XP_011512974.1 Gene:SERPINB6 / 5269 HGNCID:8950 Length:454 Species:Homo sapiens


Alignment Length:399 Identity:121/399 - (30%)
Similarity:191/399 - (47%) Gaps:51/399 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNK--------- 96
            |:|.|:|.:.: ..|.|:||||.|...||.:.|..:...|..::||.|    :.||         
Human    89 FALNLLKTLGK-DNSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQIL----SFNKSGGGGDIHQ 148

  Fly    97 --QQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFN---TLLYGA-TKELDFKND 155
              |.:|........|         ..|..|||:|.:::.:..:.|.   ...|.| .:||||.:.
Human   149 GFQSLLTEVNKTGTQ---------YLLRMANRLFGEKSCDFLSSFRDSCQKFYQAEMEELDFISA 204

  Fly   156 PETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINE 220
            .|...|.||.|:|:||..:|.::||...:.|.|.|||.||.|.:|.|..||..|.|..:.|.:::
Human   205 VEKSRKHINTWVAEKTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKENTEERLFKVSK 269

  Fly   221 REQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKIS 285
            .|::.|.||.|...||.|....:.:||:.||    |..||           ::|||:||:.. ..
Human   270 NEEKPVQMMFKQSTFKKTYIGEIFTQILVLP----YVGKE-----------LNMIIMLPDET-TD 318

  Fly   286 LNRVISRLNADSVKKW--FERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMF-TRNATFGDL 347
            |..|...|..:...:|  .:....:::|:|||:|:.|:..::..:|..:|:...| ...|.|..:
Human   319 LRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKLEESYDMESVLRNLGMTDAFELGKADFSGM 383

  Fly   348 TADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTI 412
            :...:||  ....|.:.::|:|.|:.|||||..::.....:..| :|..:|||:|.|...|.:.|
Human   384 SQTDLSL--SKVVHKSFVEVNEEGTEAAAATAAIMMMRCARFVP-RFCADHPFLFFIQHSKTNGI 445

  Fly   413 LFAGVYSDP 421
            ||.|.:|.|
Human   446 LFCGRFSSP 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 119/394 (30%)
SERPINB6XP_011512974.1 PAI-2 82..454 CDD:239013 120/397 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.