DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and SERPINB5

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_002630.2 Gene:SERPINB5 / 5268 HGNCID:8949 Length:375 Species:Homo sapiens


Alignment Length:398 Identity:100/398 - (25%)
Similarity:186/398 - (46%) Gaps:50/398 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSY-T 104
            |::.|.||:.|..|.||:.|||.....:|.||...:...|..|:.|.|:..   |.:.|...: |
Human    11 FAVDLFKQLCEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHFE---NVKDVPFGFQT 72

  Fly   105 LAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFNTLLYGATKE--------LDFKNDPETGLK 161
            :....::.   .|...|....|::||:::|:|.:|    ..:||.        :|||:..|....
Human    73 VTSDVNKL---SSFYSLKLIKRLYVDKSLNLSTEF----ISSTKRPYAKELETVDFKDKLEETKG 130

  Fly   162 EINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMV 226
            :||:.|.|.|.....::|:...:...|.:::.||||..|:|:.:|...||...||.:|:.:.:.|
Human   131 QINNSIKDLTDGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFSESETKECPFRVNKTDTKPV 195

  Fly   227 YMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILP---NSNKISLNR 288
            .||:....|.|...:.:..:||:||::               ...:||.|:||   ......|.:
Human   196 QMMNMEATFCMGNIDSINCKIIELPFQ---------------NKHLSMFILLPKDVEDESTGLEK 245

  Fly   289 VISRLNADSVKKWFERA--LPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADP 351
            :..:||::|:.:|...:  ...|::||:|||:.|:.::....|..:|:..:|:.:.:.....::.
Human   246 IEKQLNSESLSQWTNPSTMANAKVKLSIPKFKVEKMIDPKACLENLGLKHIFSEDTSDFSGMSET 310

  Fly   352 ISLVIDDAQHLAKIKVDEVGSTA---AAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTIL 413
            ..:.:.:..|...:::.|.|..:   ..|.||      :..|  :.|.:|||:::|...|...|:
Human   311 KGVALSNVIHKVCLEITEDGGDSIEVPGARIL------QHKD--ELNADHPFIYIIRHNKTRNII 367

  Fly   414 FAGVYSDP 421
            |.|.:..|
Human   368 FFGKFCSP 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 99/393 (25%)
SERPINB5NP_002630.2 maspin_like 4..375 CDD:239012 99/396 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.