DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and SERPINA4

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001275961.1 Gene:SERPINA4 / 5267 HGNCID:8948 Length:464 Species:Homo sapiens


Alignment Length:471 Identity:112/471 - (23%)
Similarity:178/471 - (37%) Gaps:97/471 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHTFSLVLLALLPVVTIAALDKPEL-------SFLNEFSQ-------------IFKGERDFSLAL 45
            ||....:||.|   |.:.||...:|       |..|...|             |.....||:...
Human    38 MHLIDYLLLLL---VGLLALSHGQLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRF 99

  Fly    46 MKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNK----------QQVL 100
            ...|....|..|:||||.|...|..:....:...:..::.:  .||:.|.:          |.:|
Human   100 YYLIASETPGKNIFFSPLSISAAYAMLSLGACSHSRSQILE--GLGFNLTELSESDVHRGFQHLL 162

  Fly   101 VSYTLAQRQDEFRWRQSPMELSSANRIFVDRTIN------VSNKFNTLLYGATKELDFKNDPETG 159
              :||.........|.......|.|..|:.:.:|      .:..|:|..|          |....
Human   163 --HTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFY----------DTVGT 215

  Fly   160 LKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINE---- 220
            ::.|||.:..:|..:|.|::|  |:....::||.|..|.|..|...|....|..|.|:::|    
Human   216 IQLINDHVKKETRGKIVDLVS--ELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTTV 278

  Fly   221 ------REQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILP 279
                  ::||..:.:|         |..|...::::.|                |.|.::..|||
Human   279 RVPMMLQDQEHHWYLH---------DRYLPCSVLRMDY----------------KGDATVFFILP 318

  Fly   280 NSNKISLNRVISRLNADSVKKW----FERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTR 340
            |..|  :..:...|..:.:.:|    .:|...:|:||.||||.......|..||..:|...:|::
Human   319 NQGK--MREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSK 381

  Fly   341 NATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIY 405
            .|....:|... .|....:.|.|.:.|||.|:.|||||...:...|.|.:......|.||:.:|:
Human   382 WADLSGITKQQ-KLEASKSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFNRPFLVVIF 445

  Fly   406 DEKVDTILFAGVYSDP 421
            .....::||.|...||
Human   446 STSTQSVLFLGKVVDP 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 97/410 (24%)
SERPINA4NP_001275961.1 alpha-1-antitrypsin_like 91..458 CDD:239011 97/410 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.