DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and SERPINA1

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_000286.3 Gene:SERPINA1 / 5265 HGNCID:8941 Length:418 Species:Homo sapiens


Alignment Length:447 Identity:113/447 - (25%)
Similarity:199/447 - (44%) Gaps:61/447 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TFSLVLLA----LLPVVTIA------ALDKPELSFLNE----FSQIFKGERDFSLALMKQIREIY 53
            ::.::|||    |:| |::|      |..|.:.|..::    |::|.....:|:.:|.:|:....
Human     6 SWGILLLAGLCCLVP-VSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQS 69

  Fly    54 PSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYTLAQRQDEFR----- 113
            .|.|:||||.|...|..:....:...|..|:.:.||..        |.....||..:.|:     
Human    70 NSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFN--------LTEIPEAQIHEGFQELLRT 126

  Fly   114 --WRQSPMELSSANRIFVDRTINVSNKF----NTLLYGATKELDFKNDPETGLKEINDWIADKTH 172
              ...|.::|::.|.:|:...:.:.:||    ..|.:.....::| .|.|...|:|||::...|.
Human   127 LNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNF-GDTEEAKKQINDYVEKGTQ 190

  Fly   173 NQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFKM 237
            .:|.|::  :|:...|:..|.|..:.||:|...|:|::|..:.|.:::.....|.||.:.|.|.:
Human   191 GKIVDLV--KELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNI 253

  Fly   238 TIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWF 302
            ...:.|.|.::.:.|                ..:.:.|..||:..|  |..:.:.|..|.:.|:.
Human   254 QHCKKLSSWVLLMKY----------------LGNATAIFFLPDEGK--LQHLENELTHDIITKFL 300

  Fly   303 ERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTAD-PISLVIDDAQHLAKIK 366
            |....:...|.|||.......:|..:|..:|:..:|:..|....:|.: |:.|  ..|.|.|.:.
Human   301 ENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKL--SKAVHKAVLT 363

  Fly   367 VDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDPRQ 423
            :||.|:.||.|..|.....|..|: .||  |.|||||:.::...:.||.|...:|.|
Human   364 IDEKGTEAAGAMFLEAIPMSIPPE-VKF--NKPFVFLMIEQNTKSPLFMGKVVNPTQ 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 99/392 (25%)
SERPINA1NP_000286.3 alpha-1-antitrypsin_like 55..412 CDD:239011 99/390 (25%)
RCL 368..392 9/26 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.