DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and SERPINF1

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001316832.1 Gene:SERPINF1 / 5176 HGNCID:8824 Length:418 Species:Homo sapiens


Alignment Length:431 Identity:102/431 - (23%)
Similarity:186/431 - (43%) Gaps:68/431 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PVVTIAALDKPELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSS 77
            |..|.|.:::.:..|....:::.....:|...|.:......|:.|:..||.|...||......:.
Human    33 PDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAE 97

  Fly    78 EQTERELAQALNLGWALNK------QQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVS 136
            ::||..:.:||......:.      :::|.:.|..|:           .|.||:||..::.:.:.
Human    98 QRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQK-----------NLKSASRIVFEKKLRIK 151

  Fly   137 NKFNTLL---YGATKELDFKNDPETGLKEINDWIADKTHNQIRDML--SSEEITPHTMLVLANAA 196
            :.|...|   || |:......:|...|:|||:|:    ..|::..|  |::||.....::|...|
Human   152 SSFVAPLEKSYG-TRPRVLTGNPRLDLQEINNWV----QAQMKGKLARSTKEIPDEISILLLGVA 211

  Fly   197 YMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGA-FKMTIDEGLQSQIIKLPYRTIYKSKE 260
            :.||||:::|...:|:|:.|:::|.....|.||....| .:..:|..|..:|.:||.        
Human   212 HFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPL-------- 268

  Fly   261 THISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKIE-----LSLPKFQFE 320
                    ...:|:|..||  .|::.|..   |..:|:...|...:.::::     |::||.:..
Human   269 --------TGSMSIIFFLP--LKVTQNLT---LIEESLTSEFIHDIDRELKTVQAVLTVPKLKLS 320

  Fly   321 QRLELTPILSLMGVNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRS 385
            ...|:|..|..|.:.::|. :..|..:|..||.|.  ..:|.|..:.:|.|:....:..|     
Human   321 YEGEVTKSLQEMKLQSLFD-SPDFSKITGKPIKLT--QVEHRAGFEWNEDGAGTTPSPGL----- 377

  Fly   386 SRQPD----PTKFNCNHPFVFLIYDEKVDTILFAGVYSDPR 422
              ||.    |..::.|.||:|::.|.....:||.|...|||
Human   378 --QPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPR 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 95/401 (24%)
SERPINF1NP_001316832.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..39 2/5 (40%)
PEDF 40..415 CDD:239007 96/421 (23%)
O-glycosylated at one site 371..383 3/18 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.