DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Spn28F

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster


Alignment Length:410 Identity:117/410 - (28%)
Similarity:195/410 - (47%) Gaps:64/410 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLG 91
            |.::|.|:...|.              .:.||..||.|...||.:||..:..:|.:|:...|.| 
  Fly    17 FADDFYQLLAKEN--------------AANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKL- 66

  Fly    92 WALNKQQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFNTLL---YGATKELDFK 153
             ..:|::|...|  .....:...|:....||.||||:|::...:...:|.::   :.|..|....
  Fly    67 -PDDKKEVAAKY--KDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDI 128

  Fly   154 NDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFI 218
            .||......:|:|:.::|..:|:|::||.:::...::|| ||.|.||||..:|..:.|..:.|.:
  Fly   129 VDPNKASSIVNNWVDNQTRGKIKDLVSSNDMSKMELIVL-NAIYFKGQWEYKFNPKLTKKRNFRV 192

  Fly   219 NEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNK 283
            ::::...|.||....:|:...|..|.::||:||||               .|.:||:|.||:   
  Fly   193 SDQKSVPVEMMSLFQSFRAAHDSELGAKIIELPYR---------------NSSLSMLIFLPD--- 239

  Fly   284 ISLNRVISRLNADSVKKWFERALPQKIELS-------LPKFQFEQRLELTPILSLMGVNTMFTRN 341
                      ..|.:.:..::.:..|.:||       ||||:.|...:|..:|..||:...|.::
  Fly   240 ----------QVDGLSELEKKIVGFKPKLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKS 294

  Fly   342 ATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTK---FNCNHPFVFL 403
            |.|.||..:. ::.:....|.|.|:|:|.|:.|||||.||..|.| .|.|:.   ||.:|||.::
  Fly   295 ADFKDLVENS-NVHVKKVIHKAFIEVNEEGAEAAAATALLFVRYS-MPMPSSQMVFNADHPFAYV 357

  Fly   404 IYDEKVDTILFAGVYSDPRQ 423
            |.|.  :||.|.|.:..|.:
  Fly   358 IRDR--ETIYFQGHFVKPNE 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 113/393 (29%)
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 116/403 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446254
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.