DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Spn42Da

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster


Alignment Length:431 Identity:120/431 - (27%)
Similarity:198/431 - (45%) Gaps:59/431 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLLALLPV-------VTIAALDKPELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPF 63
            |:.|||.|.       ||:|  |.....|....:.       ||:.:..::....|..|:.||||
  Fly    15 LLGLALFPFPPVHTADVTMA--DAAHQEFARRLAL-------FSINVYGKLSGQKPGENIVFSPF 70

  Fly    64 STYNALLLAYFSSSEQTERELAQALNLGWALNKQ------QVLVSYTLAQRQDEFRWRQSPMELS 122
            |......:|...:..:|..:|.|.|.|..:..:|      |||.:|            |....|.
  Fly    71 SIQTCAAMARLGAENETATQLDQGLGLASSDPEQIAHSFHQVLAAY------------QDSQILR 123

  Fly   123 SANRIFVDRTINVSNKFNTLL----YGATKELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEE 183
            .||:|||.....:..:|:.||    ..|.:.:||..:.:.. ..||:|:..:|::.|:|::.::.
  Fly   124 IANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAA-ATINNWVEQRTNHLIKDLVPADV 187

  Fly   184 ITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQII 248
            :...:.|||.||.:.||.|..||....|....|.::......|.||.....|:......|.:..:
  Fly   188 LNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFRYADLPALDAMAL 252

  Fly   249 KLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKIELS 313
            :|||:               .||:||:|:|||: |..|..:..:|...::.:..:.....|:.|.
  Fly   253 ELPYK---------------DSDLSMLIVLPNT-KTGLPALEEKLRLTTLSQITQSLYETKVALK 301

  Fly   314 LPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAAT 378
            ||:|:.|.::||:.:...:|::.||:..|.||.:...|..|.:....|.|.|:|:|.|:.|||||
  Fly   302 LPRFKAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAAT 366

  Fly   379 ILLV--SRSSRQP-DPTKFNCNHPFVFLIYDEKVDTILFAG 416
            .:.|  .|:...| :|.:|..:|||.:::..:| |..||.|
  Fly   367 GMAVRRKRAIMSPEEPIEFFADHPFTYVLVHQK-DLPLFWG 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 110/393 (28%)
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 110/399 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446275
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.