DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and serpinb5

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001011282.1 Gene:serpinb5 / 496735 XenbaseID:XB-GENE-5802997 Length:379 Species:Xenopus tropicalis


Alignment Length:406 Identity:97/406 - (23%)
Similarity:173/406 - (42%) Gaps:70/406 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQAL--------NLGWALNKQQVLV 101
            :.|::.|...:.|...||....::|.|....|...|..||.:||        :.|:.|....:  
 Frog    15 IFKKLCEKSATDNFVCSPLCISSSLSLIRKGSQGNTASELEKALHFEKVKDPDFGFQLLSSDI-- 77

  Fly   102 SYTLAQRQDEFRWRQSPMELSSAN------RIFVDRTINVSNKFNTLLYGATK-------ELDFK 153
                             .::||||      |::||.:|.....|   :..|.|       .:|||
 Frog    78 -----------------SKISSANSLKLLKRVYVDNSIECKKDF---INSAKKPYPLELETIDFK 122

  Fly   154 NDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFI 218
            :..|....:||..:.:.|......:|:......:|.:::..||..||:|:..|...||....|.|
 Frog   123 SQAEEARTQINSSVKELTDGNFETVLNEGSCDENTKIIMLGAASFKGKWVYTFNKSETKEMDFHI 187

  Fly   219 NEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILP---N 280
            |::|.:.|.|||......:.....|::.::::|:::               ...||:|:||   .
 Frog   188 NKKETKPVQMMHLEARLSIGYINELKTMVLEMPFQS---------------KHFSMLILLPKDIE 237

  Fly   281 SNKISLNRVISRLNADSVKKWFERAL--PQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNAT 343
            .:...|.::...:..:....|...::  ..|:::|||||:.|...:|..:|..:|:|..|...|:
 Frog   238 DDSTGLKKLEQDMTFEKYTHWTNPSMMANSKVKVSLPKFKMENSYDLKDMLKSLGINDAFNEEAS 302

  Fly   344 -FGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDE 407
             |.::| :...:.|..|...|.|:|||.|:.:|.     ||...|..:..:|..:|||::::...
 Frog   303 DFSEMT-ESKGISISQAIQKACIEVDEDGTESAD-----VSMERRLMNKEEFLADHPFIYILRHN 361

  Fly   408 KVDTILFAGVYSDPRQ 423
            |..||:..|.|..|.:
 Frog   362 KTRTIIMLGRYCGPSE 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 95/399 (24%)
serpinb5NP_001011282.1 serpinB5_maspin 1..375 CDD:381013 96/402 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.