DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and serpinb1l1

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001009892.2 Gene:serpinb1l1 / 494155 ZFINID:ZDB-GENE-040715-5 Length:384 Species:Danio rerio


Alignment Length:392 Identity:117/392 - (29%)
Similarity:189/392 - (48%) Gaps:29/392 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYTL 105
            |||.|.|:|.....|||:|:||.|..:||.:....:...|..::.:.|......::....:....
Zfish    11 FSLNLFKKISGGNASGNVFYSPVSISSALAMVSLGAKGNTADQMFKVLGFNSQAHQPVEQIHSNF 75

  Fly   106 AQRQDEFRWRQSPMELSSANRIFVDRTINVSNKF--NTLLY--GATKELDFKNDPETGLKEINDW 166
            .:...|....::|..||.|||::.::|..:..||  :|..|  ...:::||.|..|.....||.|
Zfish    76 KKFMSELNKPEAPYVLSLANRLYGEQTYQLIEKFLNDTKRYYDAGLEKVDFINKSEDARVNINTW 140

  Fly   167 IADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHK 231
            :...|..:|:|:|.|..|...|.|||.||.|.||.|..:|..|.|....|.:|:.:.:.|.|||:
Zfish   141 VEKNTQEKIKDLLPSGAIDAMTRLVLVNAIYFKGNWEEKFPKEATRDGVFRLNKNQTKPVKMMHQ 205

  Fly   232 TGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPN---SNKISLNRVISRL 293
            ...|.....|.::|.:::|||               :..::||:||||:   .....|.::...|
Zfish   206 KAEFPSGYIEEMKSHVLELPY---------------AGKNLSMLIILPDEIEDETTGLQKLERAL 255

  Fly   294 NADSVKKWFERAL--PQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADPIS--L 354
            ..:.:.:|.:..:  .:::::|||||:.||..::..:|..||:..:|.....  :||....|  |
Zfish   256 TYEKLMEWTKPEVMHQREVQVSLPKFKTEQTYDMKSLLVSMGMEDVFDPQKV--NLTGMSSSNDL 318

  Fly   355 VIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYS 419
            |:..|.|.|.::|:|.|:.|||||..:.......| |..||.:|||:|.|......:|||.|...
Zfish   319 VLSKAIHKAFVEVNEEGTEAAAATAAIEKLMCYIP-PLSFNADHPFLFFIRHNPTKSILFYGRLC 382

  Fly   420 DP 421
            .|
Zfish   383 SP 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 116/387 (30%)
serpinb1l1NP_001009892.2 PAI-2 4..384 CDD:239013 116/390 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.