DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and serpinb6

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001007932.1 Gene:serpinb6 / 493311 XenbaseID:XB-GENE-1001870 Length:379 Species:Xenopus tropicalis


Alignment Length:398 Identity:119/398 - (29%)
Similarity:190/398 - (47%) Gaps:46/398 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQ---QVLVS 102
            |::..:|:|.|...:||:|.||.|..:||.:....:...|..:::|.|.|....:..   |.|:|
 Frog    11 FAINFLKKINESNKTGNIFVSPLSISSALSMVLLGAKGNTATQMSQVLKLDKVDDAHCNFQSLIS 75

  Fly   103 YTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFNTLLYGAT--------KELDFKNDPETG 159
                    |.....:...|.:|||::.:::.....:|    .|:|        |.:||....|..
 Frog    76 --------EINKSGTNYLLRTANRLYGEKSYTFLEEF----LGSTQKHYHADLKAVDFSRKAEES 128

  Fly   160 LKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQE 224
            ..|||:|:|.||..:|:|:|||..:...|.|||.||.|.||.|.::|..:.|...||.:|:.|.:
 Frog   129 RGEINEWVAQKTEGKIKDLLSSGSVDSLTRLVLVNAIYFKGNWANKFNPDHTHESPFRLNKNETK 193

  Fly   225 MVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILP---NSNKISL 286
            .|.||.|...|.||....|.::::::||               ..:::||||:||   |.....|
 Frog   194 PVQMMFKKAKFPMTYIGELFTKVVEIPY---------------VDNELSMIILLPDDINDGTTGL 243

  Fly   287 NRVISRLNADSVKKWFERALPQ--KIELSLPKFQFEQRLELTPILSLMGVNTMF-TRNATFGDLT 348
            ..:...|..:...||....:..  ::|||||||:.|...:|...||.||::..| .|.|.|..::
 Frog   244 EALEKELTYEKFLKWTNPEMMDITEMELSLPKFKLEDDYDLESFLSTMGMSDAFDQRRADFSGMS 308

  Fly   349 ADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTIL 413
            : ...|.:....|.:.:.|:|.|:.|||||..::........| :..|:|||:|.|......:||
 Frog   309 S-ANDLFLSKVLHKSFVDVNEEGTEAAAATAAIMMLRCAMIIP-RIVCDHPFLFFILHRPSQSIL 371

  Fly   414 FAGVYSDP 421
            |.|.::.|
 Frog   372 FCGRFALP 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 118/393 (30%)
serpinb6NP_001007932.1 PAI-2 4..379 CDD:239013 118/396 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.