DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and nec

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster


Alignment Length:425 Identity:116/425 - (27%)
Similarity:184/425 - (43%) Gaps:75/425 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQA 87
            |..|:::.||.          .|.|:|.:.....|:.|||||.:..|.|.|.:|..:|.|||.:|
  Fly   102 PVFSYMDRFSS----------ELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKA 156

  Fly    88 LNLGWALNKQQVLVSYTLAQRQD-----EFRWRQSPMELSSANRIFVDRTINVSN----KFNTLL 143
                ...:|..:.|:      ||     :::......:|:.|.:::.:|.:...|    ::....
  Fly   157 ----GEFSKNAMAVA------QDFESVIKYKKHLEGADLTLATKVYYNRELGGVNHSYDEYAKFY 211

  Fly   144 YGA-TKELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFK 207
            :.| |:.:|.:|..:|..| ||.|:.|.|.|:|||:::..::.|.|..:|.||.|.:|:|..:|.
  Fly   212 FSAGTEAVDMQNAKDTAAK-INAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFA 275

  Fly   208 VEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDI 272
            ..:|:...|.........|.||.....:.:.....|.:..::|.|:               .|..
  Fly   276 TMDTSPYDFQHTNGRISKVAMMFNDDVYGLAELPELGATALELAYK---------------DSAT 325

  Fly   273 SMIIILPNSN-------------KISLNRVISRLNADSVKKWFERALPQKIELSLPKFQFEQRLE 324
            ||:|:|||..             :..||||..||..            |.:.:.|||||||...:
  Fly   326 SMLILLPNETTGLGKMLQQLSRPEFDLNRVAHRLRR------------QSVAVRLPKFQFEFEQD 378

  Fly   325 LTPILSLMGVNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQP 389
            :|..|..:||:.|||.|:....|...|:.  :......|.|.|.|.|:.|:||:.......|..|
  Fly   379 MTEPLKNLGVHQMFTPNSQVTKLMDQPVR--VSKILQKAYINVGEAGTEASAASYAKFVPLSLPP 441

  Fly   390 DPTKFNCNHPFVFLIYDEKVDTILFAGVYSDPRQM 424
            .||:|..|.||||.:  ....::||.|....|..|
  Fly   442 KPTEFVANRPFVFAV--RTPASVLFIGHVEYPTPM 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 110/403 (27%)
necNP_524851.1 SERPIN 108..468 CDD:238101 112/411 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446274
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.