DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and serpinf1

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001004539.1 Gene:serpinf1 / 447800 ZFINID:ZDB-GENE-040912-2 Length:406 Species:Danio rerio


Alignment Length:411 Identity:96/411 - (23%)
Similarity:165/411 - (40%) Gaps:80/411 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYT 104
            ||...|.:|:.......::|.||.|...|.......:||:.|:::.:||..            :|
Zfish    50 DFGYNLFRQLASRDTKASVFLSPMSISAAFTQLSMGASERAEKQIYRALRY------------HT 102

  Fly   105 L--AQRQDEFR-----WRQSPMELSSANRIFVDRTINVSNKFNTLLYGATKELDFKNDPE----- 157
            |  :|..|..|     .|.|.....||.||.:.|.:.:     .|.|..:.|..:...|:     
Zfish   103 LQDSQLHDTLRDLLSSLRASAKGFKSAERILLARKLRL-----RLEYLNSVEKQYGERPQILAGG 162

  Fly   158 -TGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINER 221
             ..||.:|||...:|..:: |.:....:..:|.|:...:||.||:|:::|. :...::.|..:.:
Zfish   163 ARDLKTVNDWFKQQTGGKV-DQVVPSPLPRNTALLPVGSAYFKGKWITRFG-KPNKMETFRRDGQ 225

  Fly   222 EQEMVYMMHKTG-AFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKIS 285
            ...::.||.:.. ..||.||..|...|.::|                .:..:||...||:....:
Zfish   226 APAVIPMMEQENYPVKMGIDSDLGCTIAQVP----------------MEDGVSMYFFLPDEVTQN 274

  Fly   286 LNRVISRLNADSVKKWFERALPQKIELSLPKFQFEQRLELTPILSLMGVN-----TMFTRNATFG 345
            |..:...|.|:.|:.........|:.|:||..:...:..|.|.||.:|::     |..|:     
Zfish   275 LTLIEEALTAEFVQDLSNSLHTVKVLLTLPVIKLSYKTNLLPSLSDLGLSEWLAETDLTK----- 334

  Fly   346 DLTADPISL-------VIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFL 403
             :|:.|:.|       |::.|...|     |..||..:||        .|.....:..:.||:||
Zfish   335 -ITSQPVKLNAVHHKVVLETAPEGA-----EYASTTPSAT--------GQSLGLSYRVDRPFLFL 385

  Fly   404 IYDEKVDTILFAGVYSDPRQM 424
            :.||....:||.|...:|..:
Zfish   386 VRDEPSGALLFIGKVLNPSDL 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 95/403 (24%)
serpinf1NP_001004539.1 SERPIN 30..403 CDD:294093 95/406 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.