DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Spn100A

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_651818.1 Gene:Spn100A / 43642 FlyBaseID:FBgn0039795 Length:649 Species:Drosophila melanogaster


Alignment Length:369 Identity:85/369 - (23%)
Similarity:161/369 - (43%) Gaps:78/369 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 AQRQDEFRWRQSPMELSSANRIFVDRTINVSNKF------NTLLYGATKEL-----DFKNDPETG 159
            |::|..   ::|..|.|....:..:.|:....|.      ..|..|..:::     ..:|..:|.
  Fly   285 AEKQQN---KRSDQEESQIKNLEENETVQEEEKLAKIMAAPALTAGEPEKVRLPLQKLENAVKTA 346

  Fly   160 LKEIND--WIADKTH-------NQIRDMLSSEEIT--------------PHTMLVLANAAYMKGQ 201
            .|:..|  .:|.::|       |..|.:...::||              ..:.::|.|..|.:|.
  Fly   347 AKDGADEIMLALESHLPSVSRVNGARSLFQQDDITSALSANSITGRSAGSKSKMLLFNGLYYRGS 411

  Fly   202 WLSQF-KVEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHIST 265
            |.:.| ::.:.:.:.||:...:.....|||..|.|::.....::::::.|||.|           
  Fly   412 WANPFYQLRDGSDEFFFMTNEDAVKAPMMHARGKFQVADLPQVKARVLSLPYET----------- 465

  Fly   266 PESKSDISMIIILPNSNKISLNRVISRLNADS---VKKWFERALPQKIELSLPKFQFEQRLELTP 327
                |..::.|:||:..: .|:.|||:|....   .||.|:.   :::.:|:||||.|:......
  Fly   466 ----SRYALCIVLPDETE-GLSDVISQLQTSDFLLAKKQFQM---KELHISMPKFQVEETSRSEA 522

  Fly   328 ILSLMGVNTMFTR-NATFGDLTADPISLVIDDAQHLAKIKVDEVGSTA---AAATILLVSRSSR- 387
            :|..||:..:|:| .|....|:.|| .:.:|:......::|||.||:|   :|||:...:.|.. 
  Fly   523 MLKQMGLKKVFSRTEAQLSLLSEDP-DVHVDEIVQFVNVRVDEGGSSANSLSAATMQARTPSVES 586

  Fly   388 ------QPDP-----TKFNCNHPFVFLIYDEKVDTILFAG-VYS 419
                  :|:|     .:|..|.||.:.|.|.:...:|.:| :|:
  Fly   587 TVLPVPEPEPELPGVERFEVNRPFAYFIVDCQEQFVLASGKIYT 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 84/366 (23%)
Spn100ANP_651818.1 SERPIN 41..>148 CDD:294093
SERPIN <380..628 CDD:294093 67/267 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.