DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpinb6e

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001039000.2 Gene:Serpinb6e / 435350 MGIID:2667778 Length:429 Species:Mus musculus


Alignment Length:403 Identity:114/403 - (28%)
Similarity:199/403 - (49%) Gaps:44/403 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNL-----GWA 93
            :.:....|:|.|.:.:.| ..|.|:|||..|.:::|.|....::..|..:::|.|:|     |.|
Mouse    56 LLEANATFTLKLFRVLGE-DSSKNVFFSSSSMFSSLALILMGANGTTASQISQVLSLDKCSNGGA 119

  Fly    94 LNKQQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFNTLLYG----ATKELDFKN 154
            ..:|......|...:.|      :...|..||:||.|...::...|....|.    ..::||||.
Mouse   120 DVQQGFQSLLTEVNKTD------TGHMLRRANKIFSDNNFDIMESFKESCYKLYRVEIEKLDFKG 178

  Fly   155 DPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFIN 219
            .||...:.||.|:|.||.:.||::||...:..:|.|:|.||.|.||:|..||..|:|...||.::
Mouse   179 TPEQCRQHINAWVAKKTKDVIRELLSLYTVNSNTRLILVNATYFKGKWEKQFNKEDTREMPFKVS 243

  Fly   220 EREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKI 284
            :.|::.|.||.|...||....|.:.:.|:.|||               :..::||||:||: .::
Mouse   244 KNEKKTVQMMSKKSTFKTYYAEEISTTIVFLPY---------------TDKELSMIIMLPD-EQV 292

  Fly   285 SLNRVISRLNADSVKKW--FERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRN-ATFGD 346
            .|:.|.::::...:.:|  ..:...:::::.||:|:.|...::..:|..:|:...|..: |.|..
Mouse   293 ELSMVENQISYKKLIQWTRLVKMEEEEVQVFLPRFKLEATYDMKDVLCKLGMTDAFEESRADFSG 357

  Fly   347 LTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNC---NHPFVFLIYDEK 408
            :::.. .|.:.:..|.:.::|:|.|:.||.||.::...|     |....|   :.||:|||..:|
Mouse   358 ISSKK-GLFLSNVVHKSFVEVNEEGTEAAVATEIVTVGS-----PLTQRCLIADRPFLFLIQGDK 416

  Fly   409 VDTILFAGVYSDP 421
            ...|||.|.:|.|
Mouse   417 SKEILFLGRFSSP 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 112/395 (28%)
Serpinb6eNP_001039000.2 serpin 53..429 CDD:393296 113/401 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.