DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Acp76A

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster


Alignment Length:424 Identity:78/424 - (18%)
Similarity:160/424 - (37%) Gaps:127/424 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SQIFKG--ERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQAL--NLGW 92
            |.:|:.  :::.|..|:::| :.|...|...|..:....|...:.:.:.::..:|.::|  |.|:
  Fly    14 SLLFQNTIQQNVSFQLIREI-DRYTPENFVLSVLNIEMILFEIHAAKAVESNNDLERSLIINFGY 77

  Fly    93 ALNKQQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKF---NTLLYGATKELDFKN 154
            :..:|:|| .:.|..:      :.|..:...||::.|.:.:.:|.|.   |.:|..:.|:.|...
  Fly    78 SEARQEVL-DWGLRYK------KASSAKFQMANKVAVSQKLPLSQKLRLVNEVLMTSAKKYDVTK 135

  Fly   155 DPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFIN 219
            |.... |.:::|::......:.:.:..:::.....:|..:...:...|.|.|:.|   :..:|:|
  Fly   136 DVRPS-KLMDEWLSSHLDGVLANFVQEKKLNAGENIVAISGMTVTPLWASHFQSE---INRYFVN 196

  Fly   220 -------EREQEMVYMMHKTGAFK-MTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMII 276
                   .::...|.|||...:|: |:.||.          :.||        .|.|.:::.|:|
  Fly   197 NPGTGYASKDPTCVPMMHSLSSFETMSTDEA----------KGIY--------IPFSSANLGMLI 243

  Fly   277 ILPNSN---KISLNRVISRLNAD--------------------SVKKWF----------ERALPQ 308
            :||...   |..|:.:.:::|.:                    ::.|:|          :.|...
  Fly   244 LLPRKGVTCKDILDNLNNQINVEYNDHKDVHLLLPIFKEKFDYNIAKFFNGINIEDTFKDSAFKS 308

  Fly   309 KIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGST 373
            |.::.:..|:....:...|||.|.                      |:||.         :.|.|
  Fly   309 KAKIKINNFRVNHGIRFQPILRLE----------------------VVDDI---------DTGKT 342

  Fly   374 AAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDE 407
            ..                  |..|.||||:|.|:
  Fly   343 ET------------------FEVNRPFVFVIKDK 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 76/419 (18%)
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 76/416 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.