DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpinb3d

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_958764.1 Gene:Serpinb3d / 394252 MGIID:2683295 Length:387 Species:Mus musculus


Alignment Length:405 Identity:118/405 - (29%)
Similarity:197/405 - (48%) Gaps:52/405 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYTL 105
            |:|.|.:|:||  ...|:|:||.|....|.:....:...||:::.:.|:    .|:.....:...
Mouse    11 FTLELYRQLRE--SDNNIFYSPISMMRTLAMLLLGAKANTEQQIKKVLH----FNETTKKTTEKS 69

  Fly   106 AQRQDEFR-WRQSPMELSSANRIFVDRTINVSNKFNTLLYGA--------------------TKE 149
            |:..||.. .:|..|.::..|:......:.|.|.    :|||                    .:.
Mouse    70 AESHDEENVHQQFQMLMTQLNKFNNAYDLKVPNS----IYGAKDFPFLQTFLKDIRKYYQANVES 130

  Fly   150 LDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALK 214
            |||.:..|...|:||.|:|.:|:.:|:|:..|..:...|:|||.||.|.||||..:|..:.|..:
Mouse   131 LDFAHAAEESQKKINSWMARQTNGKIKDLFPSGSLNSSTILVLVNAVYFKGQWNHKFDEKHTREE 195

  Fly   215 PFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILP 279
            .|::|:...:.|.||.:...|.....|.:|::|:::|    ||.||           :||.::||
Mouse   196 KFWLNKNTSKPVQMMKQRNKFNFIFLENVQAKIVEIP----YKGKE-----------LSMFVLLP 245

  Fly   280 NSNKISLNRVISRLNADSVKKW--FERALPQKIELSLPKFQFEQRLELTPILSLMG-VNTMFTRN 341
            .... .|.:...:|.||.:.:|  .|.....::.||||:|:.|::.:|...|..|| |:....:.
Mouse   246 VEID-GLKKFEEQLTADKLLQWTRAENMHMTELYLSLPQFKVEEKYDLRVPLEHMGMVDAFDPQK 309

  Fly   342 ATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYD 406
            |.|..: ::...||:....|.:.::|:|.|:.||.| :.:.|||...|.|..|:|||||:|::..
Mouse   310 ADFSGM-SNSQGLVVSKVLHKSFVEVNEEGAEAATA-MSVESRSLSVPKPNDFSCNHPFLFVMKQ 372

  Fly   407 EKVDTILFAGVYSDP 421
            .|.::|||.|..|.|
Mouse   373 NKTNSILFFGRVSSP 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 116/400 (29%)
Serpinb3dNP_958764.1 SERPIN 7..387 CDD:294093 117/403 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.