DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and serpine2

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_956478.1 Gene:serpine2 / 393153 ZFINID:ZDB-GENE-040426-848 Length:395 Species:Danio rerio


Alignment Length:397 Identity:104/397 - (26%)
Similarity:187/397 - (47%) Gaps:48/397 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYT 104
            |..|.:..|:.:.....|:..||....:.|.:....:...|.|:|...|       |.:....|.
Zfish    32 DLGLQVFMQVLQDRAQENVLLSPHGVASVLGMLLPGAHGDTRRQLLNGL-------KYKKNGPYK 89

  Fly   105 LAQRQDEFRWRQSPMEL-SSANRIFVDRTINVSNKFNTLLYGATKE--------LDFKNDPETGL 160
            :.::..:....:|..:: :.||.:|.:...::...|    ..|.:|        :|: :|||...
Zfish    90 MLRKLHKSLTTKSNADIVTIANALFPNEGFSMKEDF----LSANRENFLCESHSVDY-SDPEAAA 149

  Fly   161 KEINDWIADKTHNQIRDMLSSEEI-TPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQE 224
            :.||||:.:.|..||..:::::.. |..|.||..|:.:.||.|.|:|:.:.|..:.|...:....
Zfish   150 QSINDWVKNSTKGQIPSVVTADMFDTALTRLVAVNSIFFKGLWKSRFQPQSTKPRSFTAGDGNTY 214

  Fly   225 MVYMMHKTGAFKM---TIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISL 286
            .|.||.:...|.|   :..:|.:..:|:|||.               .:.:||.|.||..:...|
Zfish   215 KVPMMSQLSVFNMGQASTPDGQKYIVIELPYH---------------GNSMSMFIALPTEDSTPL 264

  Fly   287 NRVISRLNADSVKKWFERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRN-ATFGDLTAD 350
            :.::..::.::::.|.:...|:::.|.:|||..||.|:|...|..:|:..:|.:| |.|..|:::
Zfish   265 SSILPHISTNTIQSWTKLMNPRRMRLLMPKFTVEQELDLETPLKALGIKDIFDQNKADFRHLSSE 329

  Fly   351 PISLVIDDAQHLAKIKVDEVGSTAAAAT-ILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILF 414
              |:.:..|...|||:|:|.|:.|:|.| ::|.:|||    |.....:.||:|||......||||
Zfish   330 --SIYVSKALQKAKIEVNEDGTKASATTSVILHARSS----PPWVTVDRPFLFLIRHNSSGTILF 388

  Fly   415 AGVYSDP 421
            ||..:.|
Zfish   389 AGQINKP 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 103/392 (26%)
serpine2NP_956478.1 PAI-1_nexin-1 26..395 CDD:239006 103/395 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.