DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and SERPINA2

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_006211.2 Gene:SERPINA2 / 390502 HGNCID:8985 Length:421 Species:Homo sapiens


Alignment Length:401 Identity:83/401 - (20%)
Similarity:177/401 - (44%) Gaps:56/401 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNK-------- 96
            |.:..|.|::.::..:.|:..:|.|...|..:....:...|..|:.:.||:......        
Human    59 DLAFDLYKELADLSQTSNVLVTPTSVAMAFAMLSLGTKADTRTEILEGLNVNLTETPEAKIHECF 123

  Fly    97 QQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKF----NTLLYGATKELDFKNDPE 157
            ||||.:.:   |.|      :.::|::.:.:||::::.:.:.|    ..|.:.....::|: |.|
Human   124 QQVLQALS---RPD------TRLQLTTGSSLFVNKSMKLVDTFLEDTKKLYHSEASSINFR-DTE 178

  Fly   158 TGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINERE 222
            ...::||:::..:|..::.|::  :.:...|.|.|.:.....|:|..:||.|...::.|.::::.
Human   179 EAKEQINNYVEKRTGRKVVDLV--KHLKKDTSLALVDYISFHGKWKDKFKAEHIMVEGFHVDDKT 241

  Fly   223 QEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKI-SL 286
            ...|.|::..|.|.:..|..|.|.::...|                ..:.:...|||:..|: .|
Human   242 IIRVPMINHLGRFDIHRDRELSSWVLAQHY----------------VGNATAFFILPDPKKMWQL 290

  Fly   287 NRVISRLNADSVKKWFERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTAD- 350
            ...::..:.:::::.|:   .:.|.|..||.......:|..:|..:|:..:|:..|....::.: 
Human   291 EEKLTYSHLENIQRAFD---IRSINLHFPKLSISGTYKLKRVLRNLGITKIFSNEADLSGVSQEA 352

  Fly   351 PISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNC---NHPFVFLIYDEKVDTI 412
            |:.|  ..|.|:|.:.:||.|:.|..|..|      .:...:|:..   |.||:.:|.|:..:..
Human   353 PLKL--SKAVHVAVLTIDEKGTEATGAPHL------EEKAWSKYQTVMFNRPFLVIIKDDITNFP 409

  Fly   413 LFAGVYSDPRQ 423
            ||.|...:|.|
Human   410 LFIGKVVNPTQ 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 81/394 (21%)
SERPINA2NP_006211.2 SERPIN 62..418 CDD:214513 80/394 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.