DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpinb1c

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:XP_006516771.1 Gene:Serpinb1c / 380839 MGIID:2445363 Length:408 Species:Mus musculus


Alignment Length:423 Identity:110/423 - (26%)
Similarity:189/423 - (44%) Gaps:59/423 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TIAALDKPELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQT 80
            ::||....:||..|..         |:|.|...:.|..|:||..|||.|..:||.:.|..:...|
Mouse    28 SVAAFTMGQLSSANNL---------FALELFHTLNESNPTGNTIFSPVSISSALAMVYLGARGST 83

  Fly    81 ERELAQALNLGWALNKQQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFNTLL-- 143
            ..:|::.|:...|.:......|.|.     |...|.:...|..|||::.::|.|...::...:  
Mouse    84 AAQLSKTLHFDSAEDIHSQFQSLTA-----EVSKRGASHTLKLANRLYGEKTYNFLPEYLASIQK 143

  Fly   144 -YGATKEL-DFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQF 206
             |.|...| ||::..|...||||.|:..:|..:|:::.:...:...|.|||.||.|.||.|..:|
Mouse   144 TYSADLALVDFQHASEDARKEINQWVKGQTEEKIQELFAVGVVDSMTKLVLVNATYFKGMWQKKF 208

  Fly   207 KVEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSD 271
            ...:|...||.::::..:.|.||:............|:.:::::||:               ..:
Mouse   209 MARDTTDAPFRLSKKVTKTVKMMYLKNNLPFGYIPDLKCKVLEMPYQ---------------GGE 258

  Fly   272 ISMIIILP---NSNKISLNRVISRLNADSVKKWFERALPQKIE--LSLPKFQFEQRLELTPILSL 331
            :||:|:||   ......|..:..:|   :::|..|....|.|:  :.||||:.|:...|...|..
Mouse   259 LSMVILLPEDIEDETTGLEEIEKQL---TLEKLQECENLQNIDVCVKLPKFKMEESYILNSNLGQ 320

  Fly   332 MGVNTMFTRNATFGDLT--ADPISLVIDDAQHLAKIKVDEVGSTAAAA---TIL---LVSRSSRQ 388
            :||..:|  :::..||:  :....|.|....|.:.::|:|.|:...||   |::   |:      
Mouse   321 LGVQDLF--SSSKADLSGMSGSRDLFISKIVHKSYVEVNEEGTETDAAMPGTVVGCCLM------ 377

  Fly   389 PDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDP 421
              |.:|..:|||:|.|.......:||.|....|
Mouse   378 --PMEFTVDHPFLFFIRHNPTAHVLFLGRVCSP 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 104/397 (26%)
Serpinb1cXP_006516771.1 serpinB1_LEI 34..408 CDD:381028 107/415 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.