DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpina11

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_955018.2 Gene:Serpina11 / 380780 MGIID:2685741 Length:427 Species:Mus musculus


Alignment Length:402 Identity:93/402 - (23%)
Similarity:178/402 - (44%) Gaps:58/402 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYT 104
            :|:|.|.||:.| ..:||:.|||.|..::|.|....:...|:.::.::|..           :.|
Mouse    61 NFALRLYKQLAE-EVAGNILFSPVSLSSSLALLSLGAHADTQTQILESLGF-----------NLT 113

  Fly   105 LAQRQDEFRWRQS----------PMELSSANRIFVDRTINVSNKF---NTLLYGATK-ELDFKND 155
            .....|..|..||          .:||...:.:|:||.:....:|   ...||||.. ..:|...
Mouse   114 ETPAADVHRGFQSLLHTLDLPSPKLELKLGHFLFLDRQLKPQQRFLDSAKELYGALAFSANFTEA 178

  Fly   156 PETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQF-KVEETALKPFFIN 219
            ..|| ::|||.:..:|:.|:...|  .|.:..|::||.|..:.|.:....| :.:....:.|.::
Mouse   179 AATG-QQINDLVRKQTYGQVVGCL--PEFSHDTLMVLLNYIFFKAKCKHPFDRYQTRKQESFSLD 240

  Fly   220 EREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKI 284
            :|....:.||.:....:...|:.....::::.|                .....::::||:..| 
Mouse   241 QRTPLRIPMMRQKEMHRFLYDQEASCTVLQIEY----------------SGTALLLLVLPDPGK- 288

  Fly   285 SLNRVISRLNADSVKKWFERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTA 349
             :.:|.:.|..:::::|.:|.||..::|.||:|.......|..||.|:|:..:|...|....:..
Mouse   289 -MQQVEAALQPETLRRWGQRFLPSLLDLHLPRFSISATYNLEEILPLIGLGNLFDMEADLSGIMG 352

  Fly   350 DPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQP-----DPTKFNCNHPFVFLIYDEKV 409
            . ::..:....|.|.:.::|.|:.||||:.||    |:.|     ...:.:.|.||:.|:::...
Mouse   353 Q-LNKTVSRVSHKAIVDMNEKGTEAAAASGLL----SQPPALNMTSAPQAHYNRPFLLLLWEVTT 412

  Fly   410 DTILFAGVYSDP 421
            .::||.|...:|
Mouse   413 QSLLFLGKVVNP 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 92/397 (23%)
Serpina11NP_955018.2 SERPIN 58..421 CDD:294093 92/397 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.