DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Spn47C

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster


Alignment Length:397 Identity:99/397 - (24%)
Similarity:181/397 - (45%) Gaps:48/397 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQV----LV 101
            |:..|.:.:.:..|..|:..||....:|:.|.:..:..::..||...|.|| ..||.:|    ..
  Fly    18 FARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILG-VSNKSEVAKQHAE 81

  Fly   102 SYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFNTLLYGATKELDFKN---------DPE 157
            |:|     ||....:..:.|....|::|:....:...||.:      .|:|.|         :||
  Fly    82 SWT-----DECSCAKKGVALRLVTRLYVNEEEKIRTDFNDM------ALEFFNAEAYSLNYLNPE 135

  Fly   158 TGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINERE 222
            ..:|::|.|:...|...:|::.:.|.....:.::|.|:.:.:.:|...|..:.|.:..|:||.|:
  Fly   136 DSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFWINPRQ 200

  Fly   223 QEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNS--NKIS 285
            :..|.||.:.|.|:....:.|:|||::||:               .:|:::|:||||.:  ....
  Fly   201 RMEVSMMRQIGQFRYGESKKLKSQILQLPF---------------ERSNLTMMIILPTAIDGLPE 250

  Fly   286 LNRVISRLNADSVKKWFERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMF-TRNATFGDLTA 349
            |...:.:|:.:.|.   .::|.:::::::|||:.|..::|...|..||:|::| ...|...||..
  Fly   251 LEEKLGQLDMNEVA---AKSLMKEVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFE 312

  Fly   350 DPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILF 414
            ......|.:|:|...:.|.|.|...|....:......:.||...|..:.||||.|.|.|  .:.|
  Fly   313 MKTPQKISEARHKVFLNVTEFGCEVAPEAEVQPEVLKKNPDRKFFKADRPFVFAIRDRK--NVYF 375

  Fly   415 AGVYSDP 421
            .|.:..|
  Fly   376 VGHFVKP 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 98/392 (25%)
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 98/392 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446279
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.