DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and serpind1

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_878300.1 Gene:serpind1 / 359841 ZFINID:ZDB-GENE-030711-2 Length:507 Species:Danio rerio


Alignment Length:396 Identity:107/396 - (27%)
Similarity:177/396 - (44%) Gaps:43/396 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FSLALMKQIR-EIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYT 104
            |...|.:::| .:..:.|:..:|.....|:.:........|:.:|.|.:.....:|......:.|
Zfish   141 FGFRLYRKLRNRLNQTDNILLAPVGISIAMGMMGLGVGPNTQEQLFQTVGFAEFVNASNHYDNST 205

  Fly   105 -------LAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKF----NTLLYGATKELDFKNDPET 158
                   |..|.  || |.....|.|.|.::|.|.:.:.:.|    .|..:...:.:||. || .
Zfish   206 VHKLFRKLTHRL--FR-RNFGYTLRSVNDLYVKRNVQIQDSFRADAKTYYFAEPQSVDFA-DP-A 265

  Fly   159 GLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQ 223
            .|.:.|..|...|...|::.|.|  :.|:..::|.|..|.||.|..:|..|.|..:.|.:||::|
Zfish   266 FLVKANQRIQKITKGLIKEPLKS--VDPNMAVMLLNYLYFKGTWEQKFPKELTHHRQFRVNEKKQ 328

  Fly   224 EMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNR 288
            ..|.||...|::....|..|...|::|||                ..:|||:|.:|  .|:|..|
Zfish   329 VRVLMMQNKGSYLAAADHELNCDILQLPY----------------AGNISMLIAVP--QKLSGMR 375

  Fly   289 VISR-LNADSVKKWFERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADPI 352
            .:.: ::...|.||......:..|:..|:|:.||..:|...|..||:..:||....|..:|::.:
Zfish   376 SLEQEISPTLVNKWLSNMTNRTREVVFPRFKLEQNYDLIEHLKEMGMTDIFTEKGDFSPMTSEKV 440

  Fly   353 SLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGV 417
              :|:..:|...|.|:|.|:.|||.|.:.....|.|   |:|..:.||:||||:.:...::|.|.
Zfish   441 --IINWFKHQGSITVNEEGTEAAAMTHIGFMPLSTQ---TRFIVDRPFLFLIYEHRTGCVVFMGR 500

  Fly   418 YSDPRQ 423
            ..||.|
Zfish   501 VVDPSQ 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 104/389 (27%)
serpind1NP_878300.1 HCII 61..505 CDD:239002 105/393 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.