DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Spn42Db

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster


Alignment Length:398 Identity:112/398 - (28%)
Similarity:189/398 - (47%) Gaps:42/398 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSE--QTERELAQALNLGW 92
            ||:|   |...|:|.|...:.......|:.:||.|.:.:..:....:||  .|.:|:.:.|..| 
  Fly     5 EFAQ---GLEQFALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFG- 65

  Fly    93 ALNKQQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFNTLL----YGATKELDFK 153
            .|..|||..|:.:..:..|     ....|..||.::|.:.:.|..:|..:|    .....|:||.
  Fly    66 GLEAQQVAESFGVVLKSYE-----QCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFG 125

  Fly   154 NDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFI 218
            ::....:  ||.|:..:|:|.|:|::....:|..:.|.|.|..:.||:|...|..:||..:.||.
  Fly   126 SEQAASI--INKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFG 188

  Fly   219 NEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPN--S 281
            ::|... |.|||....|...:....::..:::.|               |..:::|||:||:  |
  Fly   189 SDRPTR-VRMMHVCENFFFAVLPMFEATALRMNY---------------SACNLAMIILLPDEKS 237

  Fly   282 NKISLNRVISRLNADSVKKWFERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGD 346
            |..||.:.:|.::.:.|......   :|:::.:|.|..|.:.||:.:|.|||:|.:|:..|..|.
  Fly   238 NLTSLEKKLSDISLEVVSSAMNL---EKVDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGG 299

  Fly   347 LTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLV---SRSSRQPDPTKFNCNHPFVFLIYDEK 408
            :.....||.:....|.|.|:::|||:.|||||..:.   |..:||..|..|:.|.||.:.|.| .
  Fly   300 MLQSEESLFVSQIVHKAFIEINEVGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKD-N 363

  Fly   409 VDTILFAG 416
            ...:||||
  Fly   364 THGLLFAG 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 109/391 (28%)
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 108/388 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446276
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.