DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and CG43366

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster


Alignment Length:468 Identity:85/468 - (18%)
Similarity:164/468 - (35%) Gaps:127/468 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 EIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLG--WALNKQQVLVSYTLAQRQDEFR 113
            :|..:.:|..|||:..:.|.:.:..:...|..|:.:.|.|.  ...|...:..:.|.:..|    
  Fly  1701 KISSARSLVISPFALTSMLSMVFLGARGSTSGEMNEILKLDDMVTFNPHLIFKNITNSVEQ---- 1761

  Fly   114 WRQSPMELSSA---NRIFVDRTINVSNKFNTLLYGATKELDFKNDPETGLKEINDWIADKTHNQI 175
              .|..::::|   ..||.||   .:.|........|::|...:..|.....:||.:..:|:..:
  Fly  1762 --ASDSDIATAAFVREIFSDR---ANGKILPFFKEKTQQLYAGHVEEVNFHVVNDIVRRRTNLLV 1821

  Fly   176 RDMLSSEEITPHTM-----LVLANAAYMKGQWLS-QFKVEETALKPFFINEREQEMVYMMHKTGA 234
            :         .|||     .:..|:.::.|...: ...:.:|........:|:.||.:.:|.|..
  Fly  1822 K---------RHTMGKVLEYLRTNSVWVNGPLATISANLFQTDCSHGSTTDRDGEMFFQVHPTVR 1877

  Fly   235 FKMTIDEGLQSQIIKLPYRTIYKS----------KETHISTPESKSDISMIIILP-NSNKISLNR 288
                     |.:::.:| ..:|:|          ..|.:|....::.:|.:.::| :.:.||...
  Fly  1878 ---------QRRLVPIP-AVLYRSGFLAGYEPSLDATVVSFGRVQNTVSTVYVMPGHQSSISPMD 1932

  Fly   289 VISRL------NADSVKKWFERALPQ-----KIELSLPKFQFEQRLELTPILSLMGVNTMFTRNA 342
            .:.||      .|.|.|:.:.|.|..     .:|:.||:|.....:..:..|..||:..:|  .:
  Fly  1933 NLDRLERSLVETAFSDKQAWRRLLTSLMDRPGMEVQLPRFSHRSFVNASLGLQKMGLRGLF--KS 1995

  Fly   343 TFGDL------------TADPISL---------------------------------VIDDAQHL 362
            .|.||            .:|.|.:                                 ..||....
  Fly  1996 DFADLRGLTGAGNRDIFLSDMIQINTFSTCGEEKISEHHHVEMYPAPPLRKRNKDVDATDDDAFD 2060

  Fly   363 AKIKVDEVGSTAAAAT------------------ILLVSRSSRQPDPTKFNCNHPFVFLIYDEKV 409
            :..:|.:.||....:.                  :.|..|.:|.||..:...:.||::.:.....
  Fly  2061 SSERVVDFGSLVQESALGRGFYDDLLDPKYLELPLPLRPRQARVPDAPRLRFDKPFLYFVRHNPT 2125

  Fly   410 DTILFAGVYSDPR 422
            ..|||.|.: :||
  Fly  2126 GMILFMGRF-NPR 2137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 83/462 (18%)
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 83/465 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.