DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Spn31A

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster


Alignment Length:372 Identity:87/372 - (23%)
Similarity:147/372 - (39%) Gaps:40/372 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 NLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYTLAQ------RQDEFRWR 115
            |:..||......|.|.:..|...|..||.:.|.|.........:.::..|:      ..|.|...
  Fly    30 NVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAKMANFYAAELGNITTDADTFLQL 94

  Fly   116 QSPMELSSANRIFVDRTINVSNKFNTLLYGATKELDFKNDPETGLKEINDWI-ADKTHNQIRDML 179
            |:.:.|||.:.:..|     ..|.....:.||.|.......|...:.|::.| |.......:|:.
  Fly    95 QNRLMLSSESGVADD-----FQKIAQTYFHATAECVDLEQTEKLRRHISEQILASVGGGSWKDIH 154

  Fly   180 SSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQ 244
            .:...:.:|:|:|. ||.::.:|...|....|.|..|....:.:.:..:.......|......|.
  Fly   155 VAGGSSANTLLLLL-AANLQSKWFLPFSAYRTGLYEFHSGSQVKSVPMLFDDDMFVKFAELRDLD 218

  Fly   245 SQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQK 309
            ::.|:|||              |...::||::|||| .:..|..:..:|:...:....:|...:.
  Fly   219 ARAIELPY--------------EHAEELSMLLILPN-QRGGLQELEKQLHDLDLGALQQRMQMEG 268

  Fly   310 IELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGS-- 372
            :::.||||..:....|...|..:|...:|..:|.|..|.|. .:|.|.|.....:|.::|.||  
  Fly   269 VQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHAS-ANLPIADVLQKLRINLNESGSGS 332

  Fly   373 ------TAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTIL 413
                  .|.....:::|.||||   ..|..:|||.|.|..|.|..::
  Fly   333 GPELPKNATEYKPIVISNSSRQ---KFFRADHPFFFAIRSENVTYLM 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 87/372 (23%)
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 87/372 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446272
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.