DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Spn28Dc

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster


Alignment Length:471 Identity:117/471 - (24%)
Similarity:193/471 - (40%) Gaps:102/471 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VTIAALDKPELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQ 79
            |.:|..|:...|.|| |:.|. |:.     |.....:||       ||.|..::|.|....:..:
  Fly   100 VDLATSDRIANSVLN-FANIL-GQH-----LANGKTQIY-------SPLSIVHSLALLLLGAKGR 150

  Fly    80 TERELAQALNL--GWALNKQQVLVSYTLAQRQDE--------FRWRQSPM-------------EL 121
            :..||:...::  ...|::|..|:...|.|...|        ..||.|..             |:
  Fly   151 SYEELSTVFDIPDTSRLHEQFGLMLQDLQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEV 215

  Fly   122 SSANRIFVDRTINVSNKFNTLL---YGATKEL-DFKNDPETGLKEINDWIADKTHNQIRDMLSSE 182
            ..||.:|......::..:..::   |.:..:: ||:..|.|....||.::|..|.|.|.::::| 
  Fly   216 HLANGLFTQTGYTLNPDYRRVIVEVYASDLQIQDFEGSPATARYNINAYVAQHTKNHIENIIAS- 279

  Fly   183 EITPHTMLVLANAAYMKGQWLSQFKVEETALKP--FFINEREQE---MVYMMHKTGAFKMTIDEG 242
            :|...|.::||||.|.|..|.:.|  .|:|.:|  |:.|....|   .|.||...||:....|..
  Fly   280 DIPQTTRMILANALYFKAFWETDF--IESATRPDNFYPNGEGTEPVMRVQMMATGGAYPYHEDHE 342

  Fly   243 LQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKI-SLNRVISRLNADSVKKWFERAL 306
            |..:||.||||       .::||        |.||.|..:.: .|..:..||.||.::....|..
  Fly   343 LGCKIIGLPYR-------GNLST--------MYIIQPFKSSVRELMALQKRLTADKIESMISRMY 392

  Fly   307 PQKIELSLPKFQFEQRLELTPILSLMGVNTMFT-------------------------------R 340
            .:...::.||....:.:.|..::..||:..:|:                               |
  Fly   393 RRAALVAFPKMHLTESVNLKTVMQRMGLGGIFSAVQNDLSLIATNEATRTNALGGNSLQNLEAQR 457

  Fly   341 NATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIY 405
            .|..|...:|   ||:||..|.....|:|.|:.|||:::..:.:|.  || ..|..:.||:.|:.
  Fly   458 RAGTGGARSD---LVVDDIVHKVDFTVNEQGTEAAASSVTYLKKSG--PD-VLFRGDTPFMVLVR 516

  Fly   406 DEKVDTILFAGVYSDP 421
            .:....:||.|:.::|
  Fly   517 HDPTKLVLFYGLINEP 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 108/444 (24%)
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 112/453 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.