DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Spn28B

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster


Alignment Length:384 Identity:112/384 - (29%)
Similarity:178/384 - (46%) Gaps:57/384 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 NLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYTLAQRQDEFRWRQSPMEL 121
            ||.:||.|....:.:.|.:|..:|..||...|.    .::.:.||:........:.:.|::.:.|
  Fly    33 NLIYSPISAEIIMSMVYMASGGKTFEELRNVLK----FSENKTLVANNYRSLLSDLKRRETFIIL 93

  Fly   122 SSANRIFVDRTINVSNKFNTLLYGATK------ELDFKNDPETGLKEINDWIADKTHNQIRDMLS 180
            ..||||:|::...:..:||.|...|.|      .||   ||.:....:|.||.::|...||:::.
  Fly    94 HMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLD---DPVSASAIVNSWILNRTRGMIRNIVL 155

  Fly   181 SEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQS 245
            .::....|...|.||.|.|||||..||.::|.:..|:::..|...|.||..:.:......:.:.:
  Fly   156 PKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSASLLSGYIDDIDA 220

  Fly   246 QIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERA----- 305
            :||:|||               ..|.:||.||||||             .|.::|..|:.     
  Fly   221 KIIELPY---------------WNSTLSMRIILPNS-------------VDGLRKLKEKVGFIDY 257

  Fly   306 -LPQK-IELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVD 368
             |.:| :.:.||||:.|.:.:|..|...:|:..:|..:|....|..:. ...||.....|.:|:|
  Fly   258 HLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLES-GAKIDKIVQKAFLKID 321

  Fly   369 EVGSTAAAATILLVSRSSR-----QPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDPR 422
            |.|..|:|||.:|..|...     || |.:|..:|||.::|:|.||  |.|.|...:||
  Fly   322 EKGGEASAATGVLTRRKKSIDNLIQP-PMEFIADHPFFYVIHDNKV--IYFQGHIVEPR 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 110/378 (29%)
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 110/378 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446256
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.