DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpina7

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_808588.3 Gene:Serpina7 / 331535 MGIID:3041197 Length:426 Species:Mus musculus


Alignment Length:403 Identity:91/403 - (22%)
Similarity:175/403 - (43%) Gaps:59/403 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYT 104
            ||:.:|.:::....|..|:||||.|...||.:..|.|...|:.::.:.|...        |....
Mouse    59 DFAFSLYRRLSVENPDLNIFFSPVSISVALAMLSFGSGSSTQTQILEVLGFN--------LTDTP 115

  Fly   105 LAQRQDEFR-------WRQSPMELSSANRIFVDRTINVSNKF----NTLLYGATKELDFKNDPET 158
            :.:.|..|:       :.::.:||...|.:|:.:.:....||    .||........||.| ...
Mouse   116 VTELQQGFQHLICSLNFPKNELELQMGNAVFIGQQLKPLAKFLDDVKTLYETEVFSTDFSN-VSA 179

  Fly   159 GLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEET-ALKPFFINERE 222
            ...:||.::..:|..:|..::...::  :.:::|.|..:.:.||.:.|:|.:| ....|.:::..
Mouse   180 AQHKINSYVEKQTKGKIVGLIQGLKL--NIIMILVNYIHFRAQWANPFRVSKTEESSNFSVDKST 242

  Fly   223 QEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLN 287
            ...|.|||:...:...:|..|...::::.|               |::.:: :.:||...  .:.
Mouse   243 TVQVPMMHQLEQYYHYVDMELNCTVLQMDY---------------SENALA-LFVLPKEG--HME 289

  Fly   288 RVISRLNADSVKKWFERALPQK--IELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTAD 350
            .|.:.:::.::|||  ..|.||  :||.:|||......:|...|..||:...|..:|.|..:|.|
Mouse   290 WVEAAMSSKTLKKW--NYLLQKGWVELFVPKFSISATYDLGSTLQKMGMRDAFAESADFPGITED 352

  Fly   351 PISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHP-------FVFLIYDEK 408
            . .|.:..|.|.|.:.:.|.| |...|:..:.|...::..|.     ||       |:.:|.:::
Mouse   353 S-GLKLSYAFHKAVLHIGEEG-TKEGASPEVGSLDQQEVPPL-----HPVIRLDRAFLLMILEKR 410

  Fly   409 VDTILFAGVYSDP 421
            ..::||.|...:|
Mouse   411 TRSVLFLGKLVNP 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 90/398 (23%)
Serpina7NP_808588.3 alpha-1-antitrypsin_like 57..419 CDD:239011 89/397 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.