DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and SERPINA9

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_783866.3 Gene:SERPINA9 / 327657 HGNCID:15995 Length:417 Species:Homo sapiens


Alignment Length:427 Identity:107/427 - (25%)
Similarity:181/427 - (42%) Gaps:53/427 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PVVTIAALDKPELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSS 77
            |....:|..:|..:.....||::....||:..|.:::....||.|:||||.|...:|.:....:.
Human    23 PANAPSAYPRPSSTKSTPASQVYSLNTDFAFRLYRRLVLETPSQNIFFSPVSVSTSLAMLSLGAH 87

  Fly    78 EQTERELAQALNLGW------ALNK--QQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTIN 134
            ..|:.::.|.|....      |:::  |.::.|.|:..:.         :.|...:.:||.:.:.
Human    88 SVTKTQILQGLGFNLTHTPESAIHQGFQHLVHSLTVPSKD---------LTLKMGSALFVKKELQ 143

  Fly   135 VSNKFNTLLYGATKEL--------DFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLV 191
            :...|    .|..|.|        ||.| |......||..:..||..::.|::...::.  |.:|
Human   144 LQANF----LGNVKRLYEAEVFSTDFSN-PSIAQARINSHVKKKTQGKVVDIIQGLDLL--TAMV 201

  Fly   192 LANAAYMKGQWLSQFKVEETALK-PFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTI 255
            |.|..:.|.:|...|..|.|... ||.:.|:....|.|||:...|...:|..|...::::.|   
Human   202 LVNHIFFKAKWEKPFHPEYTRKNFPFLVGEQVTVHVPMMHQKEQFAFGVDTELNCFVLQMDY--- 263

  Fly   256 YKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKIELSLPKFQFE 320
                         |.|.....:||:..|  :.::...|:|.:::||......:.||:.:|:|...
Human   264 -------------KGDAVAFFVLPSKGK--MRQLEQALSARTLRKWSHSLQKRWIEVFIPRFSIS 313

  Fly   321 QRLELTPILSLMGVNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATIL-LVSR 384
            ....|..||..||:..:|.:||.|..: |...||.:..|.|.|.:.|.|.|:.|.|||.. .:.|
Human   314 ASYNLETILPKMGIQNVFDKNADFSGI-AKRDSLQVSKATHKAVLDVSEEGTEATAATTTKFIVR 377

  Fly   385 SSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDP 421
            |...|.....:.|..|:.:|.::..|.|||.|...:|
Human   378 SKDGPSYFTVSFNRTFLMMITNKATDGILFLGKVENP 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 101/398 (25%)
SERPINA9NP_783866.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.