DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Spn28Db

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster


Alignment Length:386 Identity:95/386 - (24%)
Similarity:169/386 - (43%) Gaps:52/386 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNL-----GWALNKQQVL 100
            |.|.|::.:.:...| |...||......:.:....:...|..||...|:|     ..|...::::
  Fly    23 FKLNLLELVMDKAES-NFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTEMAKKYERIM 86

  Fly   101 VSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFNTLLYGATKELDFKNDPETGLKEIND 165
            .::   |:.:..|:         .|.::|:.|..|...:|||: .:|...:.| ||.:..|..|.
  Fly    87 SNF---QKHNGLRF---------TNWLYVNETYEVRQDYNTLM-KSTFMAEGK-DPLSQRKASNS 137

  Fly   166 ---WIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVY 227
               .|..|:|..:|.:.:...:..:...||.|..|..|.|.::|..::|.||.|..:..::..|.
  Fly   138 ISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKKVYVR 202

  Fly   228 MMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILP--NSNKISLNRVI 290
            ||...|.|:  |.:....|||::|:               ..||:||||.||  |:...|:.:::
  Fly   203 MMSHVGRFR--IADHSYGQIIEMPF---------------DNSDLSMIIGLPLHNTYLSSIEKIL 250

  Fly   291 SRLNADSVKKWFERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADPISLV 355
            ..|:        |..:...:.:.||||:.:.:.||...|..:|::.:|:..:....|..:.....
  Fly   251 RTLS--------ESLVENNVHVELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAK 307

  Fly   356 IDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAG 416
            |:...|.:.|:::|.|::...|:....|...:....|.|..|.||||||.|:  .|:.|.|
  Fly   308 INHVVHKSFIEINERGASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRDK--HTVYFRG 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 95/386 (25%)
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 95/386 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446259
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.