DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Eb and Serpina1f

DIOPT Version :9

Sequence 1:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001101524.1 Gene:Serpina1f / 314406 RGDID:1307899 Length:412 Species:Rattus norvegicus


Alignment Length:445 Identity:84/445 - (18%)
Similarity:177/445 - (39%) Gaps:65/445 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FSLVLLALLPVVTIAALDKPELSFLNEFSQI--FKGER------DFSLALMKQIREIYPSGNLFF 60
            ||..||.|:.:..:..:.|.:...|.|...|  |:..:      :.|:.|.|::.::..:||:.|
  Rat     6 FSRGLLLLVGLCCLLPITKTKYEDLYEDPNIDPFQCRKVALTISNISITLFKEMAQLSVNGNILF 70

  Fly    61 SPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYTLAQRQDEFRWR----QSPMEL 121
            ||.....|:.:....:.....:.:.:.|.    |||    .....|:....||:.    ..|.:|
  Rat    71 SPIRVIAAISMLSLGAKGNESKRILEILR----LNK----TGLPEAEIHKCFRYLLRAIHQPEQL 127

  Fly   122 S---SANRIFVDRTINVSNKF----NTLLYGATKELDFKNDPETGLKEINDWIADKTHNQIRDML 179
            |   |.:.:|:.:.:...:||    ..|.:.....::| .|......:||:::..|::.:|::::
  Rat   128 SPLKSGSGVFIHQDLTPVDKFVEGVKNLYHSDIVSINF-TDCRRAKTQINNYMMTKSNKEIKNIV 191

  Fly   180 SSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQ 244
            .:.|  ..|.:.:.|......:..|.|.......|.:.:.:.....|.|:|......:...|.|.
  Rat   192 KNLE--NDTYMAVVNYIIWNAKINSDFGCRSVKQKDYHLEQGMTIKVPMIHIVDLNHLFRVEDLS 254

  Fly   245 SQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQK 309
            |.::......               |:.:...|:|:..:  :.:|..||.....::...::..:.
  Rat   255 STVLVFTLLA---------------SNFTTYFIIPDIGQ--MQKVEQRLTYPHFRRMRRQSNLRM 302

  Fly   310 IELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADPISLVIDDA-----QHLAKIK--V 367
            :.|..|:....:..::..:::|:|:..:|..:|.        .|.|::|.     :.::|:|  :
  Rat   303 VNLETPELSLSETHDVESMMNLLGITYVFNNDAN--------SSAVMNDTLQKSFKMVSKVKLTI 359

  Fly   368 DEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDPR 422
            |:.||....:|..   ::....|......|.||:..|.|...|..||.|...:|:
  Rat   360 DDKGSKPGRSTCF---KNDGSVDVGYVQFNRPFLIFIKDPTNDVPLFLGRVVNPK 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 73/404 (18%)
Serpina1fNP_001101524.1 serpin 47..410 CDD:422956 73/401 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.